Introduction to SWISS-MODEL Workspace

The SWISS-MODEL Workspace is a web-based integrated service dedicated to protein structure homology modelling. It assists and guides the user in building protein homology models at different levels of complexity.

Building a homology model comprises four main steps: identification of structural template(s), alignment of target sequence and template structure(s), model building, and model quality evaluation. These steps can be repeated until a satisfying modelling result is achieved. Each of the four steps requires specialized software and access to up-to-date protein sequence and structure databases.

Protein sequence and structure databases necessary for modelling are accessible from the workspace and are updated in regular intervals. Software tools for template selection, model building, and structure quality evaluation can be invoked from within the workspace.

A personal working environment (workspace), where several modelling projects can be carried out in parallel, is provided for each user.

This help file provides references and illustrate the use of the individuals tools available from within the SWISS-MODEL Workspace.
A tutorial to facilitate the first steps of working with SWISS-MODEL Workspace as a list of most frequently asked questions is provided here: Tutorial
Please also take a look at the following published [Protocol]


Workspace

The SWISS-MODEL Workspace provides a personal web-based area for each user in which protein homology models can be built and the results of completed modelling projects are stored and visualized.

In the workspace a list of the current modeling work units and their current status is displayed: submitted (the job has been submitted to the pipeline but still queuing), running (job is running and programs are calculating), finished (job has been completed, final results are available) or failed/stopped (if something went wrong during the process).

Depending on the type of job the user has submitted a different tag will be associated with a work unit: Template Identification for template identification, Sequence Scanning for secondary structure and disorder prediction and domain assignment, Structure Assessment for structure quality assessement. And Modelling Automatic, Modelling Project, Modelling Alignment respectively for automated, alignemnt or project mode modeling requests.

After completion of the modelling procedure (~ a few minutes up to several hours), the results are stored in the workspace and the user is notified about the completion.The user can access the results output by clicking on the work unit ID number.

The results are stored for one week on the server. The remainig time before deletion of a given work unit is also displayed. The user can decide to either delete a work unit or to prolonge its life span by clicking on the corresponding link.

Beware: Each user can submit up to a maximum of 25 work units.


Domain assignment, Secondary Structure and Disorder Prediction

Many proteins are modular and made up of several structurally distinct domains, which often reflect evolutionary relationships and may correspond to units of molecular function.The sensitivity and performance of profile-based template search methods can often be improved when the template search is performed on individual domains rather than the whole target sequence. IprScan (see below) allows for protein domains and functional site prediction.
Protein disorder prediction measures and displays the propensity of protein sequences to be ordered or disordered. The result can aid the assignment of templates to a specific region of the target protein by complementing the IprScan approach to globular domains and feature discovery.
Secondary structure prediction methods are especially useful when combined with other types of analyses: e.g. in cases where only templates with very low sequence homology can be detected by sequence-based search methods, predicted secondary structure may help to decide if a putative template shares structural features of the target protein.


InterPro Domain Scan

The member databases of InterPro (Mulder et al.) allow for both the identification of protein domains and the assignment of protein function. Using the InterPro Domain Scan (IprScan, Zdobnov et al.), protein domains and functional sites can be assigned to regions of a target sequence.

The following databases are currently part of the InterPro Domain scan method:

HMMPfam: Pfam is a large collection of multiple sequence alignments and hidden Markov models covering many common protein domains and families.

HMMTigr: TIGRFAMs is a collection of protein families, featuring curated multiple sequence alignments, hidden Markov models (HMMs) and annotation, which provides a tool for identifying functionally related proteins based on sequence homology.

ProfileScan:
PROSITE is a database of protein families and domains. It consists of biologically significant sites, patterns and profiles that help to reliably identify to which known protein family (if any) a new sequence belongs. There are a number of protein families as well as functional or structural domains that cannot be detected using patterns (see below) due to their extreme sequence divergence. The use of techniques based on weight matrices (also known as profiles) allows the detection of such domains.

SuperFamily:
SUPERFAMILY is a library of profile hidden Markov models that represent all proteins of known structure, based on SCOP.

BlastProDom:
The ProDom protein domain database consists of an automatic compilation of homologous domains. Current versions of ProDom are built using a novel procedure based on recursive PSI-BLAST searches. The ProDom database has been designed as a tool to help analyze domain arrangements of proteins and protein families.

FPrintScan
: PRINTS is a compendium of protein fingerprints. A fingerprint is a group of conserved motifs used to characterise a protein family.


HMMSmart
:SMART (a Simple Modular Architecture Research Tool) allows the identification and annotation of genetically mobile domains and the analysis of domain architectures.

ScanRegExp
:PROSITE is a database of protein families and domains. It consists of biologically significant sites, patterns and profiles that help to reliably identify to which known protein family (if any) a new sequence belongs. Some biologically significant amino acid patterns can be summarised in the form of regular expressions.

The results of the InterPro domain mapping is displayed in combination with the alignment to putative template structures, allowing the user to identify template structures spanning one or more domains of the target protein. For low homology templates, the IprScan functional site annotation of the target sequence can be used to verify that putative templates share essential functional features. The InterPro functional annotations for individual template structures are accessible from the workspace as links to the SMTL library and external resources.
.

PsiPred Secondary Structure Prediction

PSIPRED is a method for protein secondary structure prediction ( Jones DT et al.).

The plot shows position in the sequence against probability of being be part of a alpha helix (H) , extended beta strand (E) or a coil region (C). The result of the prediction is plottet on the x-axis of the plot.


DISOPRED Disorder Prediction

DISOPRED (v 2) is a neural-network based predictor of disordered regions in proteins (Jones DT et al.).

The majority of water-soluble proteins have structures that are globular and relatively static. However, some proteins have regions that are natively disordered. Disordered regions are flexible, dynamic and can be partially or completely extended in solution. Native disorder also exists in global structures such as extended random coil proteins with negligible secondary structure or molten globules, which have regular secondary structure elements but have not condensed into a stable globular fold.
The primary function of disorder appears to be molecular recognition of proteins and nucleic acids. It has been speculated that the multiple metastable conformations, adopted by disordered binding sites, allows recognition of several targets with high specificity and low affinity. Order to disorder transitions also provide a mechanism for controlling protein concentration via proteolytic degradation.

The plot shows position in the sequence against probability of being disordered (from 0 to 1). The 'filter' curve represents the outputs from DISOPRED and the 'output' curve the outputs from a linear SVM classifier (DISOPREDsvm). The outputs from DISOPREDsvm are included to indicate shorter, low confidence predictions of disorder.

Asterisks (*) represent disordered predictions and dots (.) prediction of order.

The disopred predictions are given at a default false positive rate threshold of 2%. But this value can be changed by the user.


MEMSAT

MEMSAT predicts the occurrence of putative TM segment in the protein. Central TM helix segments are indicated with 'X' in the output sequence. Information about the predicted TM topology is also provided.




Template Identification

The degree of difficulty in identifying a suitable template for a target sequence can range from "trivial" for well-characterized protein families to "impossible" for proteins with an unknown fold. The SWISS-MODEL Workspace provides access to a set of increasingly complex and computationally demanding methods to search for templates.

Templates which are close homologues of the target can be identified using a gapped BLAST (Altschul et al.) query against the ExPDB template library extracted from PDB.

Options for the BLAST database search are:
E-value cutoff: sets the threshold expectation value for keeping alignments. It describes how often a given score is expected to occur random;
Matrix: the protein substitution matrix;
SEG Filter: filters the query sequence for low-complexity subsequences;
Descriptions: sets the number of database sequences for which to show the one-line summary descriptions at the top of a BLAST report;
Alignments: truncates the report to the selected number of alignments;

When no suitable templates are identified, or only parts of the target sequence are covered, two additional approaches for the sensitive detection of distant relationships among protein families are provided:

Iterative Profile Blast: the template library is searched with PSI-BLAST (Altschul et al.) using an iteratively generated sequence profile based on NR (Wheeler et al.). This method has been initially introduced as PDB-Blast by Godzik and coworkers.

- The first run searches the NR database and derive a profile for the query sequence. The following options are available:
Iterations: number of iteration for the NR database search and profile (PSSM) generation;
Matrix: the protein substitution matrix;
Evalue: The E-value threshold for inclusion in PSSM. All alignments better than this threshold are used in constructing the PSSM;
SEG Filter: filters the query sequence for low-complexity subsequences;

- Then with this profile, the final run searches the SWISS-MODEL template library (ExPDB). The following options are available:
Database to search: Clustered versions of ExPDB (e.g. ExPDB90, sequences clustered to 90% of redundancy) which combine closely related sequences into a single record;
E-value cutoff: sets the threshold expectation value for keeping alignments. It describes how often a given score is expected to occur random;
Matrix: the protein substitution matrix;
SEG
Filter: filters the query sequence for low-complexity subsequences;
Descriptions: sets the number of database sequences for which to show the one-line summary descriptions at the top of a BLAST report;
Alignments: truncates the report to the selected number of alignments;

HHSearch: To detect distantly related template structures, a target sequence can be searched against a Hidden Markov Model (HMM) based template library. Each HMM of the library is based on a multiple sequence alignment of the template sequence built by PSI-BLAST search (against nr90 & nr70) enriched with secondary structure assignment.
In analogy a HMM is built for the target sequence, which is subsequently used to search against the template library. Only alignments which score more than a given P-value cut-off are reported. Model building and library searches are performed using the HHSEARCH (v. 1.5.01) software package (Söding et al.) with default parameters.
For detailed documentation, please visit the official HHSEARCH site [http://toolkit.tuebingen.mpg.de/hhpred]

Display of template identification results

A condensed graphical view of the modeling task is provided containing the target sequence, the template matches sorted and colored according to the associated E-value, and the InterPro mappings. Clickable bars indicate the matched regions and guide the user to the underlying original program output.

In the InterPro output a link
leads to the detailed InterPro page for this entry.

In the output of the different template identification programs the template annotations (via the link to the SWISS-MODEL Template library) and target-template alignment can be retrieved.

Alignments can be obtained as DeepView project file. The latter allows the user to visualize the different alignments in the structural context of the template, to correct misplaced insertions and deletions, and to manually adjust misaligned regions. The modified project can then be saved to disk and submitted as "project mode" to the workspace for model building by the SWISS-MODEL pipeline.

When searching a clustered version of the SWISS-MODEL Template library (e.g. ExPDB90) only the alignment between the target sequence and the sequence of the representative of the cluster is shown. Information about the members of the cluster is presented in the detailed output of the different template search programs. For each template, the SWISS-MODEL workspace provides a summary showing a small ribbon representation, experimental details, information about bound molecules, as well as links to PDB (Westbrook et al.), SCOP (Andreeva et al.), CATH (Pearl et al.), PDBsum (Laskowskiet et al.), and MSD (Velankaret et al.).


Model building

Depending on the difficulty of the modelling task, three different types of modelling requests (automated mode, alignment mode, project mode) are provided, which differ in the amount of user intervention.

Modelling requests are computed by the SWISS-MODEL server homology modelling pipeline (Schwede et al.).

Automated Mode

The "automated mode" is suited for cases where the target-template similarity is sufficiently high to allow for fully automated modelling. As a rule of thumb, automated sequence alignments are sufficiently reliable when target and template share more than 50% percent of sequence identity.

This submission requires only the amino acid sequence or the UniProt accession code of the target protein as input data. The pipeline will automatically select suitable templates based on a Blast (Altschul et al.) E-value limit (which can be adjusted upon submission), experimental quality, bound substrate molecules, or different conformational states of the template.

Depending on the planned model application, it can be necessary to select a different structural template than the one ranked first in the automated process. Typical examples are proteins in different conformational states, e.g. 1ake vs. 4ake. It is possible to specify the structure to be used as modelling template either by identifying an entry in the SWISS MODEL Template library by PDB-ID + ChainID e.g. "1ake" chain "A", or by uploading a file in PDB format (*) with coordinates of the template structure. Please make sure that this file contains only a single protein chain, and does not contain chemically modified amino acids, hereto atoms, ligands, etc.

(*) A simple PDB-like file containing the coordinates of the template structure. For more information about PDB file format please see link: http://www.wwpdb.org/docs.html

Alignment Mode

Multiple sequence alignments are a common tool in many molecular biology projects. If the three-dimensional structure is known for at least one of the members, this alignment can be used as starting point for comparative modelling using the "alignment mode".
The "alignment mode" allows the user to test several alternative alignments and evaluate the quality of the resulting models in order to achieve an optimal result.

In order to facilitate the use of alignments in different formats, the submission is implemented as a three step procedure:

1. Prepare a multiple sequence alignment.

  • It must contain at least your target sequence and the template sequence
  • Use any of your favorite alignment tools. We recommend T_COFFEE by Cedric Notredame
  • Make sure the sequence names are "reasonable"

2. Submit your alignment to the Workspace Alignment Mode.

  • Possible formats are: FASTA, MSF, CLUSTALW, PFAM and SELEX
  • You may either upload your file or cut & paste
  • Don't forget to specify the correct alignment format
  • Here is a small example for testing (cut & paste):
CLUSTAL W (1.82) multiple sequence alignment
THN_DENCL       KSCCPTTAARNQYNICRLPGTPRPVCAALSGCKIISGTGCPPGYRH- 46
THNX_TEST       KSCCPDTTGRDIYNTCRFGGGSRQVCARISGCKIISASTCPS-YPNK 46
1crnA           TTCCPSIVARSNFNVCRLPGTPEALCATYTGCIIIPGATCPGDYAN- 46
                .:***  ..*  :  **: * .. :**  :** **..: **  *   

3. Select Target and Template

  • The alignment (as it was interpreted by the server) should now be displayed in the bottom part of the page.
  • The script will try to make a good guess for the correct names based on your submission.
  • Select the sequence name of the target sequence (e.g. THN_DENCL)
  • Select the sequence of the template structure (e.g. 1crnA). You don't need to use PDB IDs, you may use any name you like.
  • Specify the template structure to which this sequence belongs. This template MUST be part of the ExPDB template library. Please use the SWISS-MODEL Template library tool to check...
  • Don't forget to specify the correct CHAIN ID. Note that PDB's chain IDs are normally in capital letters.
Target  sequence:       
Template sequence:PDB-Code:Chain-ID: 

4. Check Alignment and Submit

  • The alignment at the bottom of the page should represent the correct mapping of the template structure on the target sequence. Please check carefully before submission.
  • As usual, please provide name and e-mail for the SWISS-MODEL submission.
  • Good Luck with your model ....
The server pipeline will build the model purely based on this alignment. During the modelling process, implemented as rigid fragment assembly in the SWISS-MODEL (Schwede et al.) pipeline, the modelling engine might introduce minor heuristic modifications to the placement of insertions and deletions.


Supported Alignment formats

The following formats are currently supported: FASTA, MSF, CLUSTALW, PFAM and SELEX;

Examples:

fasta
:

>THN_DENCL
KSCCPTTAARNQYNICRLPGTPRPVCAALSGCKIISGTGCPPGYRH-
>THNX_TEST
KSCCPDTTGRDIYNTCRFGGGSRQVCARISGCKIISASTCPS-YPNK
>1crnA
TTCCPSIVARSNFNVCRLPGTPEALCATYTGCIIIPGATCPGDYAN-

clustal:

CLUSTAL W (1.82) multiple sequence alignment
THN_DENCL       KSCCPTTAARNQYNICRLPGTPRPVCAALSGCKIISGTGCPPGYRH- 46
THNX_TEST       KSCCPDTTGRDIYNTCRFGGGSRQVCARISGCKIISASTCPS-YPNK 46
1crnA           TTCCPSIVARSNFNVCRLPGTPEALCATYTGCIIIPGATCPGDYAN- 46
                .:***  ..*  :  **: * .. :**  :** **..: **  *   


msf:

 !!AA_MULTIPLE_ALIGNMENT 1.0

  thn_dencl.msf MSF:  47 Type: P 08/08/05 CompCheck:  427 ..

  Name: THN_DENCL  Len: 47  Check: 8212 Weight: 1.00
  Name: THNX_TEST  Len: 47  Check: 5295 Weight: 1.00
  Name: 1crnA      Len: 47  Check: 6920 Weight: 1.00

//

           1                                            47
THN_DENCL  KSCCPTTAARNQYNICRLPGTPRPVCAALSGCKIISGTGCPPGYRH~
THNX_TEST  KSCCPDTTGRDIYNTCRFGGGSRQVCARISGCKIISASTCPS.YPNK
1crnA      TTCCPSIVARSNFNVCRLPGTPEALCATYTGCIIIPGATCPGDYAN~


Project Mode

In difficult modeling situations, where the correct alignment between target and template cannot be clearly determined by sequence based methods, visual inspection and manual manipulation of the alignment can significantly help improving the quality of the resulting model.

Project files contain the superposed template structures, and the alignment between the target and template. Project files can be generated inside the program DeepView (Swiss-PdbViewer Guex et al.), by the workspace template selection tools, and are also the default output format of the modeling pipeline. This allows analyzing and iteratively improving the the models generated by the "Automated mode" and "Alignment mode" modeling approaches.

The program DeepView can be downloaded freely from the tools section or from the ExPASy web site .


DeepView

The program DeepView (Swiss-PdbViewer, Guex et al.) can be used to generate, display, analyze and manipulate modeling project files for the SWISS-MODEL workspace.

Project files contain the superposed template structures, and the alignment between the target and template. The user has therfor full control over essential modelling parameters, i.e. the choice of template structures, the correct alignment of residues, and the placement of insertions and deletions in the context of the three-dimensional structure.

Project files can be generated inside DeepView, by the workspace template identification tools, and are also the default output format of the modeling pipeline. This allows analyzing and iteratively improving the output of the different modeling tools.


DeepView allows to visualize the model and the templates, and to analyse certain structural features e.g. Ramachandran plots or electrostatic properties. Moreover, it allows adjusting manually the placement of insertions and deletions in the alignment on which the initial modelling process was based on. The project with the modified alignment can then be re-submitted to the SWISS-MODEL workspace for model building.

DeepView can be downloaded at: http://www.expasy.org/spdbv/

DeepView does not require administrator privileges for installation. E.g. under MS windows, simply uncompress the distributed archive at any location you like (e.g. c:\spdbv or on your desktop) and start working by starting the spdbv.exe application.




Input target sequence and UniProt AC code

The amino acid sequence of a protein to be modeled or analyzed can be submitted in FASTA or raw format. If the protein sequence is deposited in the UniProt (Bairoch et al.)knowledgebase, the AC (ACcession number) for the entry can be also specified.

Examples:

- raw format: the amino acids sequence of the protein in plain-text:

MVEIVYWSGTGNTEAMANEIEAAVKAAGADVESVRFEDTNVDDVASKDVILLGCPAMGSE
ELEDSVVEPFFTDLAPKLKGKKVGLFGSYGWGSGEWMDAWKQRTEDTGATVIGTAIVNEM
PDNAPECKELGEAAAKA


- FASTA format consists of a single-line description, followed by lines of sequence data. The first character of the description line is a greater-than (">") symbol:


>sp|P00321|FLAV_MEGEL Flavodoxin - Megasphaera elsdenii.
MVEIVYWSGTGNTEAMANEIEAAVKAAGADVESVRFEDTNVDDVASKDVILLGCPAMGSE
ELEDSVVEPFFTDLAPKLKGKKVGLFGSYGWGSGEWMDAWKQRTEDTGATVIGTAIVNEM
PDNAPECKELGEAAAKA


- UniProt Accesion number: P00321



Display of modeling results

Coordinates of the model, the underlying alignment, log files, and quality evaluations can be accessed and downloaded via web-browser from the workspace.

Model Details

This section gives access to display the model and download its coordinates.

The model coordinates are available in two different formats:

  • DeepView project files (recommended).
  • PDB format

PDB formatted protein models can be displayed by any molecular visualization tool or browser-plugin. Here is a short list of freely available software:

  • DeepView (MS Windows, Macintosh, Linux)
  • DINO (Linux, IRIX, OSF,SUN)
  • Rasmol (MS Windows, Mac, Unix)
  • CHIME Plugin (requires registration)

If the model has been build using the Automated Mode, information about the template(s) used for modeling is provided with cross references to structural information databases via the link to the SWISS MODEL Template library.

Alignment Output

Displays the target template sequence alignment used in the modeling procedure and the assigned secondary structure.

Modeling Log

The modeling log gives a detailed description of the individual modeling steps. The models are built using the SWISS-MODEL server pipeline (Schwede et al.). The modelling log shows the individual steps during model building Guex et al., especially which parts of the model have been built ab initio (i.e. insertions / deletions).

Template SelectionLog

The logfile provides information about the template selection step to search the SWISS-MODEL Template library for suitable templates.


Protein Structure & Model Assessment Tools

Evaluation of model quality is a crucial step in homology modeling. While the performance of the automated SWISS-MODEL (Schwede et al.) pipeline in general is continuously evaluated by the EVA project (Koh et al.), the quality of individual models can vary significantly.

Therefore, graphical plots of Anolea mean force potential (Melo et al.) and GROMOS empirical force field energy (van Gunsteren et al.) are provided to enable the user to estimate the local quality of the predicted structure. The stereochemistry of protein models and template structures can be analysed with Whatcheck (Hooft et al.) and Procheck ( Laskowski et al.). In order to be able to rank alternative models of the same target, pseudo energies for the entire model as calculated by QMEAN (Benkert et al.) and DFIRE (Zhou et al.) are provided as well. To facilitate the description of template and model structures, DSSP (Kabsch et al.) and Promotif (Hutchinson et al.) can be invoked to classify structural features.


Anolea

The atomic empirical mean force potential ANOLEA (Melo et al.) is used to assess packing quality of the models. The program performs energy calculations on a protein chain, evaluating the "Non- Local Environment" (NLE) of each heavy atom in the molecule.

The y-axis of the plot represents the energy for each amino acid of the protein chain. Negative energy values (in green) represent favourable energy environment whereas positive values (in red) unfavourable energy environment for a given amino acid.


QMEAN

QMEAN (Benkert et al.) is a composite scoring function for the estimation of the global model quality. QMEAN consisting of five structural descriptors: The local geometry is analysed by a torsion angle potential over three consecutive amino acids. A distance-dependent pairwise residue-level potential is used to assess long-range interactions. A solvation potential describes the burial status of the residues. Two simple terms describing the agreement of predicted and calculated secondary structure and solvent accessibility, respectively, are also included.

QMEAN returns a pseudo energy of the whole model which can be used in order to compare and rank alternative models of the same target. The lower the predicted energy, the better model. Additionally, the pseudo energies of the five contributing terms are provided.

DFire

DFIRE (Zhou et al.) is an all-atom statistical potential based on a distance-scaled finite ideal-gas reference state. DFIRE is used to assess non-bonded atomic interactions in the protein model.

A pseudo energy for the entire model is provided which reflects the quality of the model and can be used for ranking alternative predictions of the same target. A lower energy indicates that a model is closer to the native conformation.


Gromos

GROMOS (van Gunsteren et al.) is a general-purpose molecular dynamics computer simulation package for the study of biomolecular systems and can be applied to the analysis of conformations obtained by experiment or by computer simulation.

The y-axis of the plot represents the energy for each amino acid of the protein chain. Negative energy values (in green) represent favourable energy environment whereas positive values (in red) unfavourable energy environment for a given amino acid.

What Check

What Check comprises several tools for protein structure verification (Hooft et al.).

Procheck

The PROCHECK suite of programs (Laskowski et al.) assess the "stereochemical quality" of a given protein structure. The aim of PROCHECK is to assess how normal, or conversely how unusual, the geometry of the residues in a given protein structure is, as compared with stereochemical parameters derived from well-refined, high-resolution structures.

PROMOTIF

PROMOTIF (Hutchinson et al.) automatically identifies, classify and analyse a number of supersecondary structural motifs in proteins. Any resulting patterns will be useful in prediction of protein structure from amino acid sequence. Motifs analyzed include beta turns, gamma turns, Greek keys, beta hairpins and beta bulges. Data from PROMOTIF analyses are included in the PDBsum (Laskowskiet et al.) web site, which provides information derived from all currently available protein coordinate files.

DSSP

The DSSP (Kabsch et al.) program defines secondary structure, geometrical features and solvent exposure of proteins, given atomic coordinates in Protein Data Bank format. The program does NOT PREDICT protein structure.
The DSSP code

H = alpha helix
B = residue in isolated beta-bridge
E = extended strand, participates in beta ladder
G = 3-helix (3/10 helix)
I = 5 helix (pi helix)
T = hydrogen bonded turn
S = bend


SwissModel Template Library (ExPDB)

The template structure database used by SWISS-MODEL (SMTL or ExPDB library) is derived from the Protein Data Bank (Westbrook et al.). In order to allow sequence-based template searches, each PDB entry is split into individual chains. The separated template chains are annotated with information about experimental method, resolution (if applicable), ANOLEA mean force potential (Melo et al.), Gromos96 energy (van Gunsteren et al.) and PQS (Henrick et al.) quaternary state assignment to allow for rapid retrieval of the relevant structural information during template selection. Theoretical models, structures only consisting of C alpha atoms and irregularly formatted database entries are removed.
In order to speed up the sequence database search step of the template identification algorithms and to provide a clear and concise overview of the results, templates sharing 100% sequence identity are grouped into a SMTL100 library using the program CD-HIT, a fast clustering method for sequences at high identity thresholds (Li et al.). Clusters of sequences having 90%, 70% and 50% sequence identity are derived from the RCSB non-redundant PDB lists.

The ExPDB codes are constructed according to the following rule: PDBCODE+ChainID

Examples:
- Light harvesting protein: 1cpc contains two chains (with IDs A & B).
The corresponding ExPDB entries are respectively:

  • Chain A: 1cpcA
  • Chain B: 1cpcB

User specified template:

Depending on the planned model application, it can be necessary to select a different structural template than the one ranked first in the automated process. Typical examples are proteins in different conformational states, e.g. 1ake vs. 4ake. It is possible to specify the structure to be used as modelling template either by identifying an entry in the SWISS-MODEL template library by PDB-ID + ChainID e.g. "1ake" chain "A", or by uploading a file in PDB format (*) with coordinates of the template structure. Please make sure that this file contains only a single protein chain, and does not contain chemically modified amino acids, hereto atoms, ligands, etc.

(*) A simple PDB-like file containing the coordinates of the template structure. For more information about PDB file format please see link: http://www.wwpdb.org/docs.html



SWISS-MODEL is developed by the Protein Structure Bioinformatics group at the SIB - Swiss Institute of Bioinformatics & the Biozentrum University of Basel. © 2011.