data_SMR-664d87291d3d8b06c50a27d90222e140_2
_entry.id SMR-664d87291d3d8b06c50a27d90222e140_2
_struct.entry_id SMR-664d87291d3d8b06c50a27d90222e140_2
_struct.pdbx_model_details
;This model was generated unsupervised by the SWISS-MODEL homology-modelling pipeline for the SWISS-MODEL Repository, a database of annotated 3D protein structure models. The modelled monomer covers following UniProtKB entries:

  - A0A2R8ZQ97/ A0A2R8ZQ97_PANPA, High affinity immunoglobulin epsilon receptor subunit gamma
  - A0A6D2XW35/ A0A6D2XW35_PANTR, High affinity immunoglobulin epsilon receptor subunit gamma
  - H2Q0G3/ H2Q0G3_PANTR, High affinity immunoglobulin epsilon receptor subunit gamma
  - P30273/ FCERG_HUMAN, High affinity immunoglobulin epsilon receptor subunit gamma

Estimated model accuracy of this model is 0.109, calculated by SWISS-MODEL as Global Model Quality Estimate (GMQE).
;
_struct.pdbx_structure_determination_methodology computational
_struct.title 'Model for UniProtKB entries A0A2R8ZQ97, A0A6D2XW35, H2Q0G3, P30273'
_audit_conform.dict_location https://raw.githubusercontent.com/ihmwg/ModelCIF/d18ba38/base/mmcif_ma-core.dic
_audit_conform.dict_name mmcif_ma.dic
_audit_conform.dict_version 1.4.6
#
loop_
_citation.id
_citation.title
_citation.journal_abbrev
_citation.journal_volume
_citation.page_first
_citation.page_last
_citation.year
_citation.pdbx_database_id_PubMed
_citation.pdbx_database_id_DOI
primary 'The SWISS-MODEL Repository - new features and functionality'
'Nucleic Acids Res.' 45 D313 D319 2017 27899672 10.1093/nar/gkw1132
2 'SWISS-MODEL: homology modelling of protein structures and complexes'
'Nucleic Acids Res.' 46 W296 W303 2018 29788355 10.1093/nar/gky427
3 'ProMod3 - A versatile homology modelling toolbox' 'PLoS Comput. Biol.' 17(1)
1 18 2021 33507980 10.1371/journal.pcbi.1008667
4 'QMEANDisCo - distance constraints applied on model quality estimation'
Bioinformatics 36 1765 1771 2020 31697312 10.1093/bioinformatics/btz828
5
'OpenStructure: an integrated software framework for computational structural biology'
'Acta Crystallogr., Sect. D: Biol. Crystallogr.' 69 701 709 2013 23633579
10.1107/S0907444913007051
6 'BLAST+: architecture and applications' 'BMC Bioinf.' 10 421 . 2009 20003500
10.1186/1471-2105-10-421
7 'HH-suite3 for fast remote homology detection and deep protein annotation'
'BMC Bioinf.' 20 473 . 2019 31521110 10.1186/s12859-019-3019-7
#
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
primary 'Bienert, S.' 1
primary 'Waterhouse, A.' 2
primary 'de Beer, T.A.P.' 3
primary 'Tauriello, G.' 4
primary 'Studer, G.' 5
primary 'Bordoli, L.' 6
primary 'Schwede, T.' 7
2 'Waterhouse, A.' 8
2 'Bertoni, M.' 9
2 'Bienert, S.' 10
2 'Studer, G.' 11
2 'Tauriello, G.' 12
2 'Gumienny, R.' 13
2 'Heer, F.T.' 14
2 'de Beer, T.A.P.' 15
2 'Rempfer, C.' 16
2 'Bordoli, L.' 17
2 'Lepore, R.' 18
2 'Schwede, T.' 19
3 'Studer, G.' 20
3 'Tauriello, G.' 21
3 'Bienert, S.' 22
3 'Biasini, M.' 23
3 'Johner, N.' 24
3 'Schwede, T.' 25
4 'Studer, G.' 26
4 'Rempfer, C.' 27
4 'Waterhouse, A.M.' 28
4 'Gumienny, R.' 29
4 'Haas, J.' 30
4 'Schwede, T.' 31
5 'Biasini, M.' 32
5 'Schmidt, T.' 33
5 'Bienert, S.' 34
5 'Mariani, V.' 35
5 'Studer, G.' 36
5 'Haas, J.' 37
5 'Johner, N.' 38
5 'Schenk, A.D.' 39
5 'Philippsen, A.' 40
5 'Schwede, T.' 41
6 'Camacho, C.' 42
6 'Coulouris, G.' 43
6 'Avagyan, V.' 44
6 'Ma, N.' 45
6 'Papadopoulos, J.' 46
6 'Bealer, K.' 47
6 'Madden, T.L.' 48
7 'Steinegger, M.' 49
7 'Meier, M.' 50
7 'Mirdita, M.' 51
7 'Vohringer, H.' 52
7 'Haunsberger, S.J.' 53
7 'Soding, J.' 54
#
#
loop_
_software.pdbx_ordinal
_software.name
_software.classification
_software.description
_software.version
_software.type
_software.location
_software.citation_id
1 SWISS-MODEL 'model building' 'Homology modelling web service' 2024-10.3
package https://swissmodel.expasy.org 2
2 ProMod3 'model building' 'Modular homology modelling engine' 3.4.1 library
https://git.scicore.unibas.ch/schwede/ProMod3 3
3 QMEAN 'model building' 'QMEAN - Qualitative Model Energy ANalysis' 4.3.1
library https://git.scicore.unibas.ch/schwede/QMEAN 4
4 OpenStructure 'data processing'
'Open-Source Computational Structural Biology Framework' 2.8.0 package
https://openstructure.org/ 5
5 BLAST 'data collection' . 2.2.31 package https://blast.ncbi.nlm.nih.gov 6
6 HH-suite 'data collection' 'HH-suite3 for sensitive sequence searching' 3.2.0
package https://github.com/soedinglab/hh-suite 7
#
#
loop_
_ma_software_group.ordinal_id
_ma_software_group.group_id
_ma_software_group.software_id
_ma_software_group.parameter_group_id
1 1 6 .
2 2 1 .
3 2 4 .
4 2 5 .
5 2 6 .
6 3 1 .
7 3 4 .
8 4 1 .
9 4 2 .
10 4 4 .
11 5 3 .
12 6 1 .
13 6 3 .
14 6 4 .
#
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
'Bienert, S.' 1
'Waterhouse, A.' 2
'de Beer, T.A.P.' 3
'Tauriello, G.' 4
'Studer, G.' 5
'Bordoli, L.' 6
'Schwede, T.' 7
#
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.name
_chem_comp.formula
_chem_comp.formula_weight
_chem_comp.ma_provenance
ALA 'L-peptide linking' ALANINE 'C3 H7 N O2' 89.094 'CCD Core'
ARG 'L-peptide linking' ARGININE 'C6 H15 N4 O2 1' 175.212 'CCD Core'
ASN 'L-peptide linking' ASPARAGINE 'C4 H8 N2 O3' 132.119 'CCD Core'
ASP 'L-peptide linking' 'ASPARTIC ACID' 'C4 H7 N O4' 133.103 'CCD Core'
CYS 'L-peptide linking' CYSTEINE 'C3 H7 N O2 S' 121.154 'CCD Core'
GLN 'L-peptide linking' GLUTAMINE 'C5 H10 N2 O3' 146.146 'CCD Core'
GLU 'L-peptide linking' 'GLUTAMIC ACID' 'C5 H9 N O4' 147.130 'CCD Core'
GLY 'peptide linking' GLYCINE 'C2 H5 N O2' 75.067 'CCD Core'
HIS 'L-peptide linking' HISTIDINE 'C6 H10 N3 O2 1' 156.165 'CCD Core'
ILE 'L-peptide linking' ISOLEUCINE 'C6 H13 N O2' 131.175 'CCD Core'
LEU 'L-peptide linking' LEUCINE 'C6 H13 N O2' 131.175 'CCD Core'
LYS 'L-peptide linking' LYSINE 'C6 H15 N2 O2 1' 147.198 'CCD Core'
MET 'L-peptide linking' METHIONINE 'C5 H11 N O2 S' 149.208 'CCD Core'
PHE 'L-peptide linking' PHENYLALANINE 'C9 H11 N O2' 165.192 'CCD Core'
PRO 'L-peptide linking' PROLINE 'C5 H9 N O2' 115.132 'CCD Core'
SER 'L-peptide linking' SERINE 'C3 H7 N O3' 105.093 'CCD Core'
THR 'L-peptide linking' THREONINE 'C4 H9 N O3' 119.120 'CCD Core'
TYR 'L-peptide linking' TYROSINE 'C9 H11 N O3' 181.191 'CCD Core'
VAL 'L-peptide linking' VALINE 'C5 H11 N O2' 117.148 'CCD Core'
#
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.details
1 polymer man . 11207.846 1 .
#
#
loop_
_struct_ref.id
_struct_ref.entity_id
_struct_ref.db_name
_struct_ref.db_code
_struct_ref.pdbx_db_accession
_struct_ref.pdbx_align_begin
_struct_ref.pdbx_seq_one_letter_code
_struct_ref.details
1 1 UNP FCERG_HUMAN P30273 1
;MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLST
RNQETYETLKHEKPPQ
;
'High affinity immunoglobulin epsilon receptor subunit gamma'
2 1 UNP H2Q0G3_PANTR H2Q0G3 1
;MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLST
RNQETYETLKHEKPPQ
;
'High affinity immunoglobulin epsilon receptor subunit gamma'
3 1 UNP A0A6D2XW35_PANTR A0A6D2XW35 1
;MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLST
RNQETYETLKHEKPPQ
;
'High affinity immunoglobulin epsilon receptor subunit gamma'
4 1 UNP A0A2R8ZQ97_PANPA A0A2R8ZQ97 1
;MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLST
RNQETYETLKHEKPPQ
;
'High affinity immunoglobulin epsilon receptor subunit gamma'
#
#
loop_
_struct_ref_seq.align_id
_struct_ref_seq.ref_id
_struct_ref_seq.seq_align_beg
_struct_ref_seq.seq_align_end
_struct_ref_seq.db_align_beg
_struct_ref_seq.db_align_end
1 1 1 86 1 86
2 2 1 86 1 86
3 3 1 86 1 86
4 4 1 86 1 86
#
#
loop_
_ma_target_ref_db_details.target_entity_id
_ma_target_ref_db_details.db_name
_ma_target_ref_db_details.db_name_other_details
_ma_target_ref_db_details.db_code
_ma_target_ref_db_details.db_accession
_ma_target_ref_db_details.seq_db_isoform
_ma_target_ref_db_details.seq_db_align_begin
_ma_target_ref_db_details.seq_db_align_end
_ma_target_ref_db_details.ncbi_taxonomy_id
_ma_target_ref_db_details.organism_scientific
_ma_target_ref_db_details.seq_db_sequence_version_date
_ma_target_ref_db_details.seq_db_sequence_checksum
1 UNP . FCERG_HUMAN P30273 . 1 86 9606 'Homo sapiens (Human)' 1993-04-01
2F2C7536513D6165
1 UNP . H2Q0G3_PANTR H2Q0G3 . 1 86 9598 'Pan troglodytes (Chimpanzee)'
2012-03-21 2F2C7536513D6165
1 UNP . A0A6D2XW35_PANTR A0A6D2XW35 . 1 86 9598 'Pan troglodytes (Chimpanzee)'
2020-06-17 2F2C7536513D6165
1 UNP . A0A2R8ZQ97_PANPA A0A2R8ZQ97 . 1 86 9597
'Pan paniscus (Pygmy chimpanzee) (Bonobo)' 2018-06-20 2F2C7536513D6165
#
#
loop_
_entity_poly.entity_id
_entity_poly.type
_entity_poly.nstd_linkage
_entity_poly.nstd_monomer
_entity_poly.pdbx_strand_id
_entity_poly.pdbx_seq_one_letter_code
_entity_poly.pdbx_seq_one_letter_code_can
1 polypeptide(L) no no B
;MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLST
RNQETYETLKHEKPPQ
;

;MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLST
RNQETYETLKHEKPPQ
;

#
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 MET .
1 2 ILE .
1 3 PRO .
1 4 ALA .
1 5 VAL .
1 6 VAL .
1 7 LEU .
1 8 LEU .
1 9 LEU .
1 10 LEU .
1 11 LEU .
1 12 LEU .
1 13 VAL .
1 14 GLU .
1 15 GLN .
1 16 ALA .
1 17 ALA .
1 18 ALA .
1 19 LEU .
1 20 GLY .
1 21 GLU .
1 22 PRO .
1 23 GLN .
1 24 LEU .
1 25 CYS .
1 26 TYR .
1 27 ILE .
1 28 LEU .
1 29 ASP .
1 30 ALA .
1 31 ILE .
1 32 LEU .
1 33 PHE .
1 34 LEU .
1 35 TYR .
1 36 GLY .
1 37 ILE .
1 38 VAL .
1 39 LEU .
1 40 THR .
1 41 LEU .
1 42 LEU .
1 43 TYR .
1 44 CYS .
1 45 ARG .
1 46 LEU .
1 47 LYS .
1 48 ILE .
1 49 GLN .
1 50 VAL .
1 51 ARG .
1 52 LYS .
1 53 ALA .
1 54 ALA .
1 55 ILE .
1 56 THR .
1 57 SER .
1 58 TYR .
1 59 GLU .
1 60 LYS .
1 61 SER .
1 62 ASP .
1 63 GLY .
1 64 VAL .
1 65 TYR .
1 66 THR .
1 67 GLY .
1 68 LEU .
1 69 SER .
1 70 THR .
1 71 ARG .
1 72 ASN .
1 73 GLN .
1 74 GLU .
1 75 THR .
1 76 TYR .
1 77 GLU .
1 78 THR .
1 79 LEU .
1 80 LYS .
1 81 HIS .
1 82 GLU .
1 83 LYS .
1 84 PRO .
1 85 PRO .
1 86 GLN .
#
#
loop_
_struct_asym.id
_struct_asym.entity_id
_struct_asym.details
A 1 .
#
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
A 1 1 MET 1 ? ? ? B .
A 1 2 ILE 2 ? ? ? B .
A 1 3 PRO 3 ? ? ? B .
A 1 4 ALA 4 ? ? ? B .
A 1 5 VAL 5 ? ? ? B .
A 1 6 VAL 6 ? ? ? B .
A 1 7 LEU 7 ? ? ? B .
A 1 8 LEU 8 ? ? ? B .
A 1 9 LEU 9 ? ? ? B .
A 1 10 LEU 10 ? ? ? B .
A 1 11 LEU 11 ? ? ? B .
A 1 12 LEU 12 ? ? ? B .
A 1 13 VAL 13 ? ? ? B .
A 1 14 GLU 14 ? ? ? B .
A 1 15 GLN 15 ? ? ? B .
A 1 16 ALA 16 ? ? ? B .
A 1 17 ALA 17 ? ? ? B .
A 1 18 ALA 18 ? ? ? B .
A 1 19 LEU 19 ? ? ? B .
A 1 20 GLY 20 ? ? ? B .
A 1 21 GLU 21 ? ? ? B .
A 1 22 PRO 22 ? ? ? B .
A 1 23 GLN 23 ? ? ? B .
A 1 24 LEU 24 ? ? ? B .
A 1 25 CYS 25 ? ? ? B .
A 1 26 TYR 26 ? ? ? B .
A 1 27 ILE 27 ? ? ? B .
A 1 28 LEU 28 ? ? ? B .
A 1 29 ASP 29 ? ? ? B .
A 1 30 ALA 30 ? ? ? B .
A 1 31 ILE 31 ? ? ? B .
A 1 32 LEU 32 ? ? ? B .
A 1 33 PHE 33 ? ? ? B .
A 1 34 LEU 34 ? ? ? B .
A 1 35 TYR 35 ? ? ? B .
A 1 36 GLY 36 ? ? ? B .
A 1 37 ILE 37 ? ? ? B .
A 1 38 VAL 38 ? ? ? B .
A 1 39 LEU 39 ? ? ? B .
A 1 40 THR 40 ? ? ? B .
A 1 41 LEU 41 ? ? ? B .
A 1 42 LEU 42 ? ? ? B .
A 1 43 TYR 43 ? ? ? B .
A 1 44 CYS 44 ? ? ? B .
A 1 45 ARG 45 ? ? ? B .
A 1 46 LEU 46 ? ? ? B .
A 1 47 LYS 47 ? ? ? B .
A 1 48 ILE 48 ? ? ? B .
A 1 49 GLN 49 ? ? ? B .
A 1 50 VAL 50 ? ? ? B .
A 1 51 ARG 51 ? ? ? B .
A 1 52 LYS 52 ? ? ? B .
A 1 53 ALA 53 ? ? ? B .
A 1 54 ALA 54 ? ? ? B .
A 1 55 ILE 55 ? ? ? B .
A 1 56 THR 56 ? ? ? B .
A 1 57 SER 57 ? ? ? B .
A 1 58 TYR 58 ? ? ? B .
A 1 59 GLU 59 ? ? ? B .
A 1 60 LYS 60 ? ? ? B .
A 1 61 SER 61 ? ? ? B .
A 1 62 ASP 62 ? ? ? B .
A 1 63 GLY 63 63 GLY GLY B .
A 1 64 VAL 64 64 VAL VAL B .
A 1 65 TYR 65 65 TYR TYR B .
A 1 66 THR 66 66 THR THR B .
A 1 67 GLY 67 67 GLY GLY B .
A 1 68 LEU 68 68 LEU LEU B .
A 1 69 SER 69 69 SER SER B .
A 1 70 THR 70 70 THR THR B .
A 1 71 ARG 71 71 ARG ARG B .
A 1 72 ASN 72 72 ASN ASN B .
A 1 73 GLN 73 73 GLN GLN B .
A 1 74 GLU 74 74 GLU GLU B .
A 1 75 THR 75 75 THR THR B .
A 1 76 TYR 76 76 TYR TYR B .
A 1 77 GLU 77 77 GLU GLU B .
A 1 78 THR 78 78 THR THR B .
A 1 79 LEU 79 79 LEU LEU B .
A 1 80 LYS 80 80 LYS LYS B .
A 1 81 HIS 81 81 HIS HIS B .
A 1 82 GLU 82 ? ? ? B .
A 1 83 LYS 83 ? ? ? B .
A 1 84 PRO 84 ? ? ? B .
A 1 85 PRO 85 ? ? ? B .
A 1 86 GLN 86 ? ? ? B .
#
#
loop_
_ma_data.id
_ma_data.name
_ma_data.content_type
_ma_data.content_type_other_details
1
'High affinity immunoglobulin epsilon receptor subunit gamma {PDB ID=7q5t, label_asym_id=K, auth_asym_id=KKK, SMTL ID=7q5t.2.B}'
'template structure' .
2 . target .
3 'Target-template alignment by HHblits to 7q5t, label_asym_id=K'
'target-template alignment' .
4 'model 2' 'model coordinates' .
5 SMTL 'reference database' .
6 PDB 'reference database' .
7 'Template search output' other 'Results of the sequence search'
#
#
loop_
_ma_data_group.ordinal_id
_ma_data_group.group_id
_ma_data_group.data_id
1 1 2
2 1 5
3 1 6
4 2 7
5 3 2
6 3 1
7 3 3
8 4 1
9 4 3
10 5 4
#
#
loop_
_ma_data_ref_db.data_id
_ma_data_ref_db.name
_ma_data_ref_db.location_url
_ma_data_ref_db.version
_ma_data_ref_db.release_date
5 SMTL https://swissmodel.expasy.org/templates/ . 2024-11-14
6 PDB https://www.wwpdb.org . 2024-11-08
#
#
loop_
_ma_target_entity.entity_id
_ma_target_entity.data_id
_ma_target_entity.origin
1 2 'reference database'
#
#
loop_
_ma_target_entity_instance.asym_id
_ma_target_entity_instance.entity_id
_ma_target_entity_instance.details
A 1 .
#
#
loop_
_ma_template_trans_matrix.id
_ma_template_trans_matrix.rot_matrix[1][1]
_ma_template_trans_matrix.rot_matrix[2][1]
_ma_template_trans_matrix.rot_matrix[3][1]
_ma_template_trans_matrix.rot_matrix[1][2]
_ma_template_trans_matrix.rot_matrix[2][2]
_ma_template_trans_matrix.rot_matrix[3][2]
_ma_template_trans_matrix.rot_matrix[1][3]
_ma_template_trans_matrix.rot_matrix[2][3]
_ma_template_trans_matrix.rot_matrix[3][3]
_ma_template_trans_matrix.tr_vector[1]
_ma_template_trans_matrix.tr_vector[2]
_ma_template_trans_matrix.tr_vector[3]
1 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000
1.000000 0 0 0
#
#
loop_
_ma_template_details.ordinal_id
_ma_template_details.template_id
_ma_template_details.template_origin
_ma_template_details.template_entity_type
_ma_template_details.template_trans_matrix_id
_ma_template_details.template_data_id
_ma_template_details.target_asym_id
_ma_template_details.template_label_asym_id
_ma_template_details.template_label_entity_id
_ma_template_details.template_model_num
_ma_template_details.template_auth_asym_id
1 1 'reference database' polymer 1 1 A K 2 1 KKK
#
#
loop_
_ma_template_poly.template_id
_ma_template_poly.seq_one_letter_code
_ma_template_poly.seq_one_letter_code_can
1 DGVYTGLSTRNQETYETLKH DGVYTGLSTRNQETYETLKH
#
#
loop_
_ma_template_poly_segment.id
_ma_template_poly_segment.template_id
_ma_template_poly_segment.residue_number_begin
_ma_template_poly_segment.residue_number_end
1 1 1 20
#
#
loop_
_ma_template_ref_db_details.template_id
_ma_template_ref_db_details.db_name
_ma_template_ref_db_details.db_name_other_details
_ma_template_ref_db_details.db_accession_code
_ma_template_ref_db_details.db_version_date
1 PDB . 7q5t 2024-10-30
#
#
loop_
_ma_target_template_poly_mapping.id
_ma_target_template_poly_mapping.template_segment_id
_ma_target_template_poly_mapping.target_asym_id
_ma_target_template_poly_mapping.target_seq_id_begin
_ma_target_template_poly_mapping.target_seq_id_end
1 1 A 1 86
#
#
loop_
_ma_alignment_info.alignment_id
_ma_alignment_info.data_id
_ma_alignment_info.software_group_id
_ma_alignment_info.alignment_length
_ma_alignment_info.alignment_type
_ma_alignment_info.alignment_mode
1 3 1 86 'target-template pairwise alignment' local
#
#
loop_
_ma_alignment_details.ordinal_id
_ma_alignment_details.alignment_id
_ma_alignment_details.template_segment_id
_ma_alignment_details.target_asym_id
_ma_alignment_details.score_type
_ma_alignment_details.score_type_other_details
_ma_alignment_details.score_value
_ma_alignment_details.percent_sequence_identity
_ma_alignment_details.sequence_identity_denominator
_ma_alignment_details.sequence_identity_denominator_other_details
1 1 1 A 'HHblits e-value' . 5.7e-06 100.000
'Number of aligned residue pairs (not including the gaps)' .
#
#
loop_
_ma_alignment.ordinal_id
_ma_alignment.alignment_id
_ma_alignment.target_template_flag
_ma_alignment.sequence
1 1 1
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
2 1 2
-------------------------------------------------------------DGVYTGLSTRNQETYETLKH-----
#
#
loop_
_ma_protocol_step.ordinal_id
_ma_protocol_step.protocol_id
_ma_protocol_step.step_id
_ma_protocol_step.method_type
_ma_protocol_step.step_name
_ma_protocol_step.details
_ma_protocol_step.software_group_id
_ma_protocol_step.input_data_group_id
_ma_protocol_step.output_data_group_id
1 1 1 'template search' 'template search' 'SWISS-MODEL template search in PDB' 2
1 2
2 1 2 'template selection' 'template selection'
'Automatic template selection by SWISS-MODEL {QSQE=0.000}' 3 2 4
3 1 3 modeling 'homology modeling'
'SWISS-MODEL auto-model mode using ProMod3 on 7q5t.2' 4 3 5
#
#
loop_
_ma_model_list.ordinal_id
_ma_model_list.model_id
_ma_model_list.model_group_id
_ma_model_list.model_name
_ma_model_list.model_group_name
_ma_model_list.data_id
_ma_model_list.model_type
_ma_model_list.model_type_other_details
1 1 1 'model 2' . 4 'Homology model' .
#
#
loop_
_atom_site.group_PDB
_atom_site.id
_atom_site.type_symbol
_atom_site.label_atom_id
_atom_site.label_alt_id
_atom_site.label_comp_id
_atom_site.label_seq_id
_atom_site.auth_seq_id
_atom_site.pdbx_PDB_ins_code
_atom_site.label_asym_id
_atom_site.Cartn_x
_atom_site.Cartn_y
_atom_site.Cartn_z
_atom_site.occupancy
_atom_site.label_entity_id
_atom_site.auth_asym_id
_atom_site.auth_comp_id
_atom_site.B_iso_or_equiv
_atom_site.pdbx_PDB_model_num
ATOM 1 N N . GLY 63 63 ? A -19.632 -57.013 39.073 1 1 B GLY 0.590 1
ATOM 2 C CA . GLY 63 63 ? A -19.331 -55.565 38.751 1 1 B GLY 0.590 1
ATOM 3 C C . GLY 63 63 ? A -17.909 -55.130 38.969 1 1 B GLY 0.590 1
ATOM 4 O O . GLY 63 63 ? A -17.652 -53.964 39.172 1 1 B GLY 0.590 1
ATOM 5 N N . VAL 64 64 ? A -16.947 -56.078 38.965 1 1 B VAL 0.660 1
ATOM 6 C CA . VAL 64 64 ? A -15.570 -55.803 39.295 1 1 B VAL 0.660 1
ATOM 7 C C . VAL 64 64 ? A -14.851 -55.303 38.059 1 1 B VAL 0.660 1
ATOM 8 O O . VAL 64 64 ? A -14.895 -55.950 37.014 1 1 B VAL 0.660 1
ATOM 9 C CB . VAL 64 64 ? A -14.917 -57.098 39.769 1 1 B VAL 0.660 1
ATOM 10 C CG1 . VAL 64 64 ? A -13.524 -56.808 40.353 1 1 B VAL 0.660 1
ATOM 11 C CG2 . VAL 64 64 ? A -15.803 -57.810 40.818 1 1 B VAL 0.660 1
ATOM 12 N N . TYR 65 65 ? A -14.188 -54.136 38.144 1 1 B TYR 0.650 1
ATOM 13 C CA . TYR 65 65 ? A -13.359 -53.629 37.075 1 1 B TYR 0.650 1
ATOM 14 C C . TYR 65 65 ? A -11.925 -53.961 37.383 1 1 B TYR 0.650 1
ATOM 15 O O . TYR 65 65 ? A -11.451 -53.797 38.509 1 1 B TYR 0.650 1
ATOM 16 C CB . TYR 65 65 ? A -13.476 -52.098 36.892 1 1 B TYR 0.650 1
ATOM 17 C CG . TYR 65 65 ? A -14.822 -51.764 36.329 1 1 B TYR 0.650 1
ATOM 18 C CD1 . TYR 65 65 ? A -15.877 -51.341 37.150 1 1 B TYR 0.650 1
ATOM 19 C CD2 . TYR 65 65 ? A -15.053 -51.924 34.957 1 1 B TYR 0.650 1
ATOM 20 C CE1 . TYR 65 65 ? A -17.146 -51.099 36.604 1 1 B TYR 0.650 1
ATOM 21 C CE2 . TYR 65 65 ? A -16.316 -51.675 34.409 1 1 B TYR 0.650 1
ATOM 22 C CZ . TYR 65 65 ? A -17.364 -51.264 35.234 1 1 B TYR 0.650 1
ATOM 23 O OH . TYR 65 65 ? A -18.629 -51.015 34.674 1 1 B TYR 0.650 1
ATOM 24 N N . THR 66 66 ? A -11.207 -54.462 36.370 1 1 B THR 0.640 1
ATOM 25 C CA . THR 66 66 ? A -9.799 -54.823 36.460 1 1 B THR 0.640 1
ATOM 26 C C . THR 66 66 ? A -8.940 -53.589 36.304 1 1 B THR 0.640 1
ATOM 27 O O . THR 66 66 ? A -9.122 -52.797 35.393 1 1 B THR 0.640 1
ATOM 28 C CB . THR 66 66 ? A -9.374 -55.824 35.397 1 1 B THR 0.640 1
ATOM 29 O OG1 . THR 66 66 ? A -10.165 -56.997 35.473 1 1 B THR 0.640 1
ATOM 30 C CG2 . THR 66 66 ? A -7.927 -56.298 35.579 1 1 B THR 0.640 1
ATOM 31 N N . GLY 67 67 ? A -7.969 -53.393 37.224 1 1 B GLY 0.570 1
ATOM 32 C CA . GLY 67 67 ? A -7.079 -52.245 37.171 1 1 B GLY 0.570 1
ATOM 33 C C . GLY 67 67 ? A -5.862 -52.555 36.362 1 1 B GLY 0.570 1
ATOM 34 O O . GLY 67 67 ? A -5.500 -53.709 36.163 1 1 B GLY 0.570 1
ATOM 35 N N . LEU 68 68 ? A -5.168 -51.509 35.881 1 1 B LEU 0.530 1
ATOM 36 C CA . LEU 68 68 ? A -3.873 -51.678 35.255 1 1 B LEU 0.530 1
ATOM 37 C C . LEU 68 68 ? A -2.831 -52.216 36.223 1 1 B LEU 0.530 1
ATOM 38 O O . LEU 68 68 ? A -2.784 -51.844 37.390 1 1 B LEU 0.530 1
ATOM 39 C CB . LEU 68 68 ? A -3.364 -50.360 34.624 1 1 B LEU 0.530 1
ATOM 40 C CG . LEU 68 68 ? A -4.303 -49.733 33.568 1 1 B LEU 0.530 1
ATOM 41 C CD1 . LEU 68 68 ? A -3.811 -48.330 33.170 1 1 B LEU 0.530 1
ATOM 42 C CD2 . LEU 68 68 ? A -4.471 -50.623 32.324 1 1 B LEU 0.530 1
ATOM 43 N N . SER 69 69 ? A -1.942 -53.109 35.739 1 1 B SER 0.740 1
ATOM 44 C CA . SER 69 69 ? A -0.926 -53.728 36.570 1 1 B SER 0.740 1
ATOM 45 C C . SER 69 69 ? A 0.244 -52.799 36.797 1 1 B SER 0.740 1
ATOM 46 O O . SER 69 69 ? A 1.087 -53.032 37.645 1 1 B SER 0.740 1
ATOM 47 C CB . SER 69 69 ? A -0.416 -55.061 35.957 1 1 B SER 0.740 1
ATOM 48 O OG . SER 69 69 ? A 0.107 -54.881 34.638 1 1 B SER 0.740 1
ATOM 49 N N . THR 70 70 ? A 0.285 -51.691 36.029 1 1 B THR 0.690 1
ATOM 50 C CA . THR 70 70 ? A 1.319 -50.689 36.154 1 1 B THR 0.690 1
ATOM 51 C C . THR 70 70 ? A 0.744 -49.359 35.733 1 1 B THR 0.690 1
ATOM 52 O O . THR 70 70 ? A -0.132 -49.295 34.875 1 1 B THR 0.690 1
ATOM 53 C CB . THR 70 70 ? A 2.555 -51.039 35.326 1 1 B THR 0.690 1
ATOM 54 O OG1 . THR 70 70 ? A 3.671 -50.214 35.606 1 1 B THR 0.690 1
ATOM 55 C CG2 . THR 70 70 ? A 2.310 -50.984 33.808 1 1 B THR 0.690 1
ATOM 56 N N . ARG 71 71 ? A 1.196 -48.246 36.348 1 1 B ARG 0.470 1
ATOM 57 C CA . ARG 71 71 ? A 0.784 -46.903 35.963 1 1 B ARG 0.470 1
ATOM 58 C C . ARG 71 71 ? A 1.584 -46.427 34.764 1 1 B ARG 0.470 1
ATOM 59 O O . ARG 71 71 ? A 2.794 -46.613 34.704 1 1 B ARG 0.470 1
ATOM 60 C CB . ARG 71 71 ? A 1.016 -45.918 37.151 1 1 B ARG 0.470 1
ATOM 61 C CG . ARG 71 71 ? A 0.843 -44.403 36.863 1 1 B ARG 0.470 1
ATOM 62 C CD . ARG 71 71 ? A 1.407 -43.443 37.925 1 1 B ARG 0.470 1
ATOM 63 N NE . ARG 71 71 ? A 0.717 -43.752 39.215 1 1 B ARG 0.470 1
ATOM 64 C CZ . ARG 71 71 ? A 1.178 -43.388 40.420 1 1 B ARG 0.470 1
ATOM 65 N NH1 . ARG 71 71 ? A 2.291 -42.673 40.552 1 1 B ARG 0.470 1
ATOM 66 N NH2 . ARG 71 71 ? A 0.527 -43.768 41.520 1 1 B ARG 0.470 1
ATOM 67 N N . ASN 72 72 ? A 0.941 -45.759 33.773 1 1 B ASN 0.570 1
ATOM 68 C CA . ASN 72 72 ? A 1.689 -45.112 32.709 1 1 B ASN 0.570 1
ATOM 69 C C . ASN 72 72 ? A 2.500 -43.931 33.243 1 1 B ASN 0.570 1
ATOM 70 O O . ASN 72 72 ? A 1.983 -43.039 33.909 1 1 B ASN 0.570 1
ATOM 71 C CB . ASN 72 72 ? A 0.780 -44.714 31.516 1 1 B ASN 0.570 1
ATOM 72 C CG . ASN 72 72 ? A 1.599 -44.219 30.319 1 1 B ASN 0.570 1
ATOM 73 O OD1 . ASN 72 72 ? A 1.917 -43.042 30.268 1 1 B ASN 0.570 1
ATOM 74 N ND2 . ASN 72 72 ? A 1.976 -45.127 29.388 1 1 B ASN 0.570 1
ATOM 75 N N . GLN 73 73 ? A 3.815 -43.950 32.971 1 1 B GLN 0.710 1
ATOM 76 C CA . GLN 73 73 ? A 4.720 -42.908 33.391 1 1 B GLN 0.710 1
ATOM 77 C C . GLN 73 73 ? A 5.592 -42.513 32.226 1 1 B GLN 0.710 1
ATOM 78 O O . GLN 73 73 ? A 6.698 -42.022 32.390 1 1 B GLN 0.710 1
ATOM 79 C CB . GLN 73 73 ? A 5.565 -43.353 34.617 1 1 B GLN 0.710 1
ATOM 80 C CG . GLN 73 73 ? A 4.765 -43.247 35.942 1 1 B GLN 0.710 1
ATOM 81 C CD . GLN 73 73 ? A 5.535 -43.604 37.219 1 1 B GLN 0.710 1
ATOM 82 O OE1 . GLN 73 73 ? A 5.305 -43.008 38.268 1 1 B GLN 0.710 1
ATOM 83 N NE2 . GLN 73 73 ? A 6.415 -44.629 37.138 1 1 B GLN 0.710 1
ATOM 84 N N . GLU 74 74 ? A 5.088 -42.701 30.986 1 1 B GLU 0.700 1
ATOM 85 C CA . GLU 74 74 ? A 5.729 -42.117 29.834 1 1 B GLU 0.700 1
ATOM 86 C C . GLU 74 74 ? A 5.479 -40.628 29.847 1 1 B GLU 0.700 1
ATOM 87 O O . GLU 74 74 ? A 4.344 -40.170 29.942 1 1 B GLU 0.700 1
ATOM 88 C CB . GLU 74 74 ? A 5.192 -42.719 28.528 1 1 B GLU 0.700 1
ATOM 89 C CG . GLU 74 74 ? A 5.315 -44.255 28.491 1 1 B GLU 0.700 1
ATOM 90 C CD . GLU 74 74 ? A 4.809 -44.797 27.160 1 1 B GLU 0.700 1
ATOM 91 O OE1 . GLU 74 74 ? A 3.576 -45.040 27.076 1 1 B GLU 0.700 1
ATOM 92 O OE2 . GLU 74 74 ? A 5.642 -44.985 26.242 1 1 B GLU 0.700 1
ATOM 93 N N . THR 75 75 ? A 6.554 -39.828 29.821 1 1 B THR 0.630 1
ATOM 94 C CA . THR 75 75 ? A 6.445 -38.394 29.978 1 1 B THR 0.630 1
ATOM 95 C C . THR 75 75 ? A 6.972 -37.715 28.751 1 1 B THR 0.630 1
ATOM 96 O O . THR 75 75 ? A 7.933 -38.155 28.132 1 1 B THR 0.630 1
ATOM 97 C CB . THR 75 75 ? A 7.173 -37.826 31.191 1 1 B THR 0.630 1
ATOM 98 O OG1 . THR 75 75 ? A 8.524 -38.240 31.296 1 1 B THR 0.630 1
ATOM 99 C CG2 . THR 75 75 ? A 6.491 -38.345 32.455 1 1 B THR 0.630 1
ATOM 100 N N . TYR 76 76 ? A 6.330 -36.599 28.353 1 1 B TYR 0.530 1
ATOM 101 C CA . TYR 76 76 ? A 6.825 -35.774 27.274 1 1 B TYR 0.530 1
ATOM 102 C C . TYR 76 76 ? A 7.567 -34.603 27.880 1 1 B TYR 0.530 1
ATOM 103 O O . TYR 76 76 ? A 7.130 -34.038 28.880 1 1 B TYR 0.530 1
ATOM 104 C CB . TYR 76 76 ? A 5.695 -35.210 26.384 1 1 B TYR 0.530 1
ATOM 105 C CG . TYR 76 76 ? A 5.149 -36.292 25.500 1 1 B TYR 0.530 1
ATOM 106 C CD1 . TYR 76 76 ? A 5.628 -36.430 24.190 1 1 B TYR 0.530 1
ATOM 107 C CD2 . TYR 76 76 ? A 4.177 -37.194 25.961 1 1 B TYR 0.530 1
ATOM 108 C CE1 . TYR 76 76 ? A 5.136 -37.438 23.353 1 1 B TYR 0.530 1
ATOM 109 C CE2 . TYR 76 76 ? A 3.682 -38.205 25.123 1 1 B TYR 0.530 1
ATOM 110 C CZ . TYR 76 76 ? A 4.156 -38.318 23.811 1 1 B TYR 0.530 1
ATOM 111 O OH . TYR 76 76 ? A 3.646 -39.287 22.925 1 1 B TYR 0.530 1
ATOM 112 N N . GLU 77 77 ? A 8.717 -34.231 27.281 1 1 B GLU 0.570 1
ATOM 113 C CA . GLU 77 77 ? A 9.484 -33.046 27.617 1 1 B GLU 0.570 1
ATOM 114 C C . GLU 77 77 ? A 8.767 -31.749 27.312 1 1 B GLU 0.570 1
ATOM 115 O O . GLU 77 77 ? A 7.868 -31.666 26.479 1 1 B GLU 0.570 1
ATOM 116 C CB . GLU 77 77 ? A 10.876 -33.047 26.944 1 1 B GLU 0.570 1
ATOM 117 C CG . GLU 77 77 ? A 11.866 -34.010 27.644 1 1 B GLU 0.570 1
ATOM 118 C CD . GLU 77 77 ? A 12.796 -33.268 28.610 1 1 B GLU 0.570 1
ATOM 119 O OE1 . GLU 77 77 ? A 12.283 -32.506 29.481 1 1 B GLU 0.570 1
ATOM 120 O OE2 . GLU 77 77 ? A 14.033 -33.440 28.471 1 1 B GLU 0.570 1
ATOM 121 N N . THR 78 78 ? A 9.172 -30.690 28.033 1 1 B THR 0.570 1
ATOM 122 C CA . THR 78 78 ? A 8.549 -29.382 27.954 1 1 B THR 0.570 1
ATOM 123 C C . THR 78 78 ? A 9.627 -28.359 27.738 1 1 B THR 0.570 1
ATOM 124 O O . THR 78 78 ? A 10.813 -28.648 27.844 1 1 B THR 0.570 1
ATOM 125 C CB . THR 78 78 ? A 7.712 -28.976 29.170 1 1 B THR 0.570 1
ATOM 126 O OG1 . THR 78 78 ? A 8.446 -28.847 30.382 1 1 B THR 0.570 1
ATOM 127 C CG2 . THR 78 78 ? A 6.630 -30.029 29.431 1 1 B THR 0.570 1
ATOM 128 N N . LEU 79 79 ? A 9.246 -27.118 27.373 1 1 B LEU 0.520 1
ATOM 129 C CA . LEU 79 79 ? A 10.219 -26.062 27.170 1 1 B LEU 0.520 1
ATOM 130 C C . LEU 79 79 ? A 10.809 -25.536 28.461 1 1 B LEU 0.520 1
ATOM 131 O O . LEU 79 79 ? A 10.189 -25.597 29.518 1 1 B LEU 0.520 1
ATOM 132 C CB . LEU 79 79 ? A 9.636 -24.931 26.304 1 1 B LEU 0.520 1
ATOM 133 C CG . LEU 79 79 ? A 9.229 -25.405 24.890 1 1 B LEU 0.520 1
ATOM 134 C CD1 . LEU 79 79 ? A 8.512 -24.294 24.106 1 1 B LEU 0.520 1
ATOM 135 C CD2 . LEU 79 79 ? A 10.433 -25.933 24.088 1 1 B LEU 0.520 1
ATOM 136 N N . LYS 80 80 ? A 12.076 -25.070 28.389 1 1 B LYS 0.450 1
ATOM 137 C CA . LYS 80 80 ? A 12.833 -24.699 29.568 1 1 B LYS 0.450 1
ATOM 138 C C . LYS 80 80 ? A 12.995 -23.203 29.689 1 1 B LYS 0.450 1
ATOM 139 O O . LYS 80 80 ? A 12.345 -22.605 30.531 1 1 B LYS 0.450 1
ATOM 140 C CB . LYS 80 80 ? A 14.209 -25.408 29.635 1 1 B LYS 0.450 1
ATOM 141 C CG . LYS 80 80 ? A 14.177 -26.953 29.727 1 1 B LYS 0.450 1
ATOM 142 C CD . LYS 80 80 ? A 13.071 -27.504 30.647 1 1 B LYS 0.450 1
ATOM 143 C CE . LYS 80 80 ? A 13.154 -29.000 30.967 1 1 B LYS 0.450 1
ATOM 144 N NZ . LYS 80 80 ? A 12.110 -29.316 31.968 1 1 B LYS 0.450 1
ATOM 145 N N . HIS 81 81 ? A 13.885 -22.568 28.895 1 1 B HIS 0.280 1
ATOM 146 C CA . HIS 81 81 ? A 13.884 -21.122 28.850 1 1 B HIS 0.280 1
ATOM 147 C C . HIS 81 81 ? A 13.026 -20.559 27.693 1 1 B HIS 0.280 1
ATOM 148 O O . HIS 81 81 ? A 12.399 -21.356 26.947 1 1 B HIS 0.280 1
ATOM 149 C CB . HIS 81 81 ? A 15.303 -20.564 28.658 1 1 B HIS 0.280 1
ATOM 150 C CG . HIS 81 81 ? A 15.955 -20.902 27.352 1 1 B HIS 0.280 1
ATOM 151 N ND1 . HIS 81 81 ? A 16.798 -22.000 27.268 1 1 B HIS 0.280 1
ATOM 152 C CD2 . HIS 81 81 ? A 16.028 -20.166 26.215 1 1 B HIS 0.280 1
ATOM 153 C CE1 . HIS 81 81 ? A 17.364 -21.897 26.086 1 1 B HIS 0.280 1
ATOM 154 N NE2 . HIS 81 81 ? A 16.937 -20.807 25.401 1 1 B HIS 0.280 1
ATOM 155 O OXT . HIS 81 81 ? A 13.038 -19.307 27.531 1 1 B HIS 0.280 1
#
#
loop_
_atom_type.symbol
C
N
O
#
#
loop_
_ma_qa_metric.id
_ma_qa_metric.name
_ma_qa_metric.description
_ma_qa_metric.type
_ma_qa_metric.mode
_ma_qa_metric.type_other_details
_ma_qa_metric.software_group_id
1 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].'
'pLDDT all-atom in [0,1]' local . 5
2 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].'
'pLDDT all-atom in [0,1]' global . 5
3 GMQE
'Global Model Quality Estimate of the model accuracy, calculated by SWISS-MODEL.'
'normalized score' global . 6
#
#
loop_
_ma_qa_metric_global.ordinal_id
_ma_qa_metric_global.model_id
_ma_qa_metric_global.metric_id
_ma_qa_metric_global.metric_value
1 1 2 0.583
2 1 3 0.109
#
#
loop_
_ma_qa_metric_local.ordinal_id
_ma_qa_metric_local.model_id
_ma_qa_metric_local.label_asym_id
_ma_qa_metric_local.label_seq_id
_ma_qa_metric_local.label_comp_id
_ma_qa_metric_local.metric_id
_ma_qa_metric_local.metric_value
1 1 A 63 GLY 1 0.590
2 1 A 64 VAL 1 0.660
3 1 A 65 TYR 1 0.650
4 1 A 66 THR 1 0.640
5 1 A 67 GLY 1 0.570
6 1 A 68 LEU 1 0.530
7 1 A 69 SER 1 0.740
8 1 A 70 THR 1 0.690
9 1 A 71 ARG 1 0.470
10 1 A 72 ASN 1 0.570
11 1 A 73 GLN 1 0.710
12 1 A 74 GLU 1 0.700
13 1 A 75 THR 1 0.630
14 1 A 76 TYR 1 0.530
15 1 A 77 GLU 1 0.570
16 1 A 78 THR 1 0.570
17 1 A 79 LEU 1 0.520
18 1 A 80 LYS 1 0.450
19 1 A 81 HIS 1 0.280
#
#
loop_
_pdbx_data_usage.id
_pdbx_data_usage.type
_pdbx_data_usage.details
_pdbx_data_usage.url
1 license
;This SWISS-MODEL protein model is copyright.
It is produced by the SWISS-MODEL server, developed by the Computational
Structural Biology Group at the SIB Swiss Institute of Bioinformatics at the
Biozentrum, University of Basel (https://swissmodel.expasy.org). This
model is licensed under the CC BY-SA 4.0 Creative Commons
Attribution-ShareAlike 4.0 International License
(https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
can copy and redistribute the model in any medium or format,
transform and build upon the model for any purpose, even
commercially, under the following terms:
Attribution - You must give appropriate credit, provide a link to
the license, and indicate if changes were made. You may do so in any
reasonable manner, but not in any way that suggests the licensor
endorses you or your use. When you publish, patent or distribute
results that were fully or partially based on the model, please cite
the corresponding papers mentioned under JRNL.
ShareAlike - If you remix, transform, or build upon the material,
you must distribute your contributions under the same license as the
original.
No additional restrictions - you may not apply legal terms or
technological measures that legally restrict others from doing
anything the license permits.
Find a human-readable summary of (and not a substitute for) the
CC BY-SA 4.0 license at this link:
https://creativecommons.org/licenses/by-sa/4.0/
;
https://creativecommons.org/licenses/by-sa/4.0/legalcode
2 disclaimer
;The SWISS-MODEL SERVER produces theoretical models for
proteins. The results of any theoretical modelling procedure is
NON-EXPERIMENTAL and MUST be considered with care. These models may
contain significant errors. This is especially true for automated
modeling since there is no human intervention during model
building. Please read the header section and the logfile carefully
to know what templates and alignments were used during the model
building process. All information by the SWISS-MODEL SERVER is
provided "AS-IS", without any warranty, expressed or implied.
;
https://swissmodel.expasy.org/docs/terms_of_use#disclaimer
#