data_SMR-ffa690b4a24907d2e00eb16f94502328_1
_entry.id SMR-ffa690b4a24907d2e00eb16f94502328_1
_struct.entry_id SMR-ffa690b4a24907d2e00eb16f94502328_1
_struct.pdbx_model_details
;This model was generated unsupervised by the SWISS-MODEL homology-modelling pipeline for the SWISS-MODEL Repository, a database of annotated 3D protein structure models. The modelled monomer covers following UniProtKB entries:

  - A0A2J8PMP0/ A0A2J8PMP0_PANTR, RRM2B isoform 5
  - Q7LG56 (isoform 2)/ RIR2B_HUMAN, Ribonucleoside-diphosphate reductase subunit M2 B

Estimated model accuracy of this model is 0.269, calculated by SWISS-MODEL as Global Model Quality Estimate (GMQE).
;
_struct.pdbx_structure_determination_methodology computational
_struct.title 'Model for UniProtKB entries A0A2J8PMP0, Q7LG56 (isoform 2)'
_audit_conform.dict_location https://raw.githubusercontent.com/ihmwg/ModelCIF/d18ba38/base/mmcif_ma-core.dic
_audit_conform.dict_name mmcif_ma.dic
_audit_conform.dict_version 1.4.6
#
loop_
_citation.id
_citation.title
_citation.journal_abbrev
_citation.journal_volume
_citation.page_first
_citation.page_last
_citation.year
_citation.pdbx_database_id_PubMed
_citation.pdbx_database_id_DOI
primary 'The SWISS-MODEL Repository - new features and functionality'
'Nucleic Acids Res.' 45 D313 D319 2017 27899672 10.1093/nar/gkw1132
2 'SWISS-MODEL: homology modelling of protein structures and complexes'
'Nucleic Acids Res.' 46 W296 W303 2018 29788355 10.1093/nar/gky427
3 'ProMod3 - A versatile homology modelling toolbox' 'PLoS Comput. Biol.' 17(1)
1 18 2021 33507980 10.1371/journal.pcbi.1008667
4 'QMEANDisCo - distance constraints applied on model quality estimation'
Bioinformatics 36 1765 1771 2020 31697312 10.1093/bioinformatics/btz828
5
'OpenStructure: an integrated software framework for computational structural biology'
'Acta Crystallogr., Sect. D: Biol. Crystallogr.' 69 701 709 2013 23633579
10.1107/S0907444913007051
6 'BLAST+: architecture and applications' 'BMC Bioinf.' 10 421 . 2009 20003500
10.1186/1471-2105-10-421
7 'HH-suite3 for fast remote homology detection and deep protein annotation'
'BMC Bioinf.' 20 473 . 2019 31521110 10.1186/s12859-019-3019-7
#
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
primary 'Bienert, S.' 1
primary 'Waterhouse, A.' 2
primary 'de Beer, T.A.P.' 3
primary 'Tauriello, G.' 4
primary 'Studer, G.' 5
primary 'Bordoli, L.' 6
primary 'Schwede, T.' 7
2 'Waterhouse, A.' 8
2 'Bertoni, M.' 9
2 'Bienert, S.' 10
2 'Studer, G.' 11
2 'Tauriello, G.' 12
2 'Gumienny, R.' 13
2 'Heer, F.T.' 14
2 'de Beer, T.A.P.' 15
2 'Rempfer, C.' 16
2 'Bordoli, L.' 17
2 'Lepore, R.' 18
2 'Schwede, T.' 19
3 'Studer, G.' 20
3 'Tauriello, G.' 21
3 'Bienert, S.' 22
3 'Biasini, M.' 23
3 'Johner, N.' 24
3 'Schwede, T.' 25
4 'Studer, G.' 26
4 'Rempfer, C.' 27
4 'Waterhouse, A.M.' 28
4 'Gumienny, R.' 29
4 'Haas, J.' 30
4 'Schwede, T.' 31
5 'Biasini, M.' 32
5 'Schmidt, T.' 33
5 'Bienert, S.' 34
5 'Mariani, V.' 35
5 'Studer, G.' 36
5 'Haas, J.' 37
5 'Johner, N.' 38
5 'Schenk, A.D.' 39
5 'Philippsen, A.' 40
5 'Schwede, T.' 41
6 'Camacho, C.' 42
6 'Coulouris, G.' 43
6 'Avagyan, V.' 44
6 'Ma, N.' 45
6 'Papadopoulos, J.' 46
6 'Bealer, K.' 47
6 'Madden, T.L.' 48
7 'Steinegger, M.' 49
7 'Meier, M.' 50
7 'Mirdita, M.' 51
7 'Vohringer, H.' 52
7 'Haunsberger, S.J.' 53
7 'Soding, J.' 54
#
#
loop_
_software.pdbx_ordinal
_software.name
_software.classification
_software.description
_software.version
_software.type
_software.location
_software.citation_id
1 SWISS-MODEL 'model building' 'Homology modelling web service' 2024-10.3
package https://swissmodel.expasy.org 2
2 ProMod3 'model building' 'Modular homology modelling engine' 3.4.1 library
https://git.scicore.unibas.ch/schwede/ProMod3 3
3 QMEAN 'model building' 'QMEAN - Qualitative Model Energy ANalysis' 4.3.1
library https://git.scicore.unibas.ch/schwede/QMEAN 4
4 OpenStructure 'data processing'
'Open-Source Computational Structural Biology Framework' 2.8.0 package
https://openstructure.org/ 5
5 BLAST 'data collection' . 2.2.31 package https://blast.ncbi.nlm.nih.gov 6
6 HH-suite 'data collection' 'HH-suite3 for sensitive sequence searching' 3.2.0
package https://github.com/soedinglab/hh-suite 7
#
#
loop_
_ma_software_group.ordinal_id
_ma_software_group.group_id
_ma_software_group.software_id
_ma_software_group.parameter_group_id
1 1 6 .
2 2 1 .
3 2 4 .
4 2 5 .
5 2 6 .
6 3 1 .
7 3 4 .
8 4 1 .
9 4 2 .
10 4 4 .
11 5 3 .
12 6 1 .
13 6 3 .
14 6 4 .
#
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
'Bienert, S.' 1
'Waterhouse, A.' 2
'de Beer, T.A.P.' 3
'Tauriello, G.' 4
'Studer, G.' 5
'Bordoli, L.' 6
'Schwede, T.' 7
#
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.name
_chem_comp.formula
_chem_comp.formula_weight
_chem_comp.ma_provenance
ALA 'L-peptide linking' ALANINE 'C3 H7 N O2' 89.094 'CCD Core'
ARG 'L-peptide linking' ARGININE 'C6 H15 N4 O2 1' 175.212 'CCD Core'
ASN 'L-peptide linking' ASPARAGINE 'C4 H8 N2 O3' 132.119 'CCD Core'
ASP 'L-peptide linking' 'ASPARTIC ACID' 'C4 H7 N O4' 133.103 'CCD Core'
CYS 'L-peptide linking' CYSTEINE 'C3 H7 N O2 S' 121.154 'CCD Core'
GLN 'L-peptide linking' GLUTAMINE 'C5 H10 N2 O3' 146.146 'CCD Core'
GLU 'L-peptide linking' 'GLUTAMIC ACID' 'C5 H9 N O4' 147.130 'CCD Core'
GLY 'peptide linking' GLYCINE 'C2 H5 N O2' 75.067 'CCD Core'
HIS 'L-peptide linking' HISTIDINE 'C6 H10 N3 O2 1' 156.165 'CCD Core'
ILE 'L-peptide linking' ISOLEUCINE 'C6 H13 N O2' 131.175 'CCD Core'
LEU 'L-peptide linking' LEUCINE 'C6 H13 N O2' 131.175 'CCD Core'
LYS 'L-peptide linking' LYSINE 'C6 H15 N2 O2 1' 147.198 'CCD Core'
MET 'L-peptide linking' METHIONINE 'C5 H11 N O2 S' 149.208 'CCD Core'
PHE 'L-peptide linking' PHENYLALANINE 'C9 H11 N O2' 165.192 'CCD Core'
PRO 'L-peptide linking' PROLINE 'C5 H9 N O2' 115.132 'CCD Core'
SER 'L-peptide linking' SERINE 'C3 H7 N O3' 105.093 'CCD Core'
THR 'L-peptide linking' THREONINE 'C4 H9 N O3' 119.120 'CCD Core'
TRP 'L-peptide linking' TRYPTOPHAN 'C11 H12 N2 O2' 204.229 'CCD Core'
TYR 'L-peptide linking' TYROSINE 'C9 H11 N O3' 181.191 'CCD Core'
VAL 'L-peptide linking' VALINE 'C5 H11 N O2' 117.148 'CCD Core'
#
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.details
1 polymer man . 5615.844 1 .
#
#
loop_
_struct_ref.id
_struct_ref.entity_id
_struct_ref.db_name
_struct_ref.db_code
_struct_ref.pdbx_db_accession
_struct_ref.pdbx_align_begin
_struct_ref.pdbx_seq_one_letter_code
_struct_ref.details
1 1 UNP A0A2J8PMP0_PANTR A0A2J8PMP0 1
MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRSF 'RRM2B isoform 5'
2 1 UNP RIR2B_HUMAN Q7LG56 1 MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRSF
'Ribonucleoside-diphosphate reductase subunit M2 B'
#
#
loop_
_struct_ref_seq.align_id
_struct_ref_seq.ref_id
_struct_ref_seq.seq_align_beg
_struct_ref_seq.seq_align_end
_struct_ref_seq.db_align_beg
_struct_ref_seq.db_align_end
1 1 1 43 1 43
2 2 1 43 1 43
#
#
loop_
_ma_target_ref_db_details.target_entity_id
_ma_target_ref_db_details.db_name
_ma_target_ref_db_details.db_name_other_details
_ma_target_ref_db_details.db_code
_ma_target_ref_db_details.db_accession
_ma_target_ref_db_details.seq_db_isoform
_ma_target_ref_db_details.seq_db_align_begin
_ma_target_ref_db_details.seq_db_align_end
_ma_target_ref_db_details.ncbi_taxonomy_id
_ma_target_ref_db_details.organism_scientific
_ma_target_ref_db_details.seq_db_sequence_version_date
_ma_target_ref_db_details.seq_db_sequence_checksum
1 UNP . A0A2J8PMP0_PANTR A0A2J8PMP0 . 1 43 9598 'Pan troglodytes (Chimpanzee)'
2018-03-28 29373C73112CBE75
1 UNP . RIR2B_HUMAN Q7LG56 Q7LG56-2 1 43 9606 'Homo sapiens (Human)' 2004-07-05
29373C73112CBE75
#
#
loop_
_entity_poly.entity_id
_entity_poly.type
_entity_poly.nstd_linkage
_entity_poly.nstd_monomer
_entity_poly.pdbx_strand_id
_entity_poly.pdbx_seq_one_letter_code
_entity_poly.pdbx_seq_one_letter_code_can
1 polypeptide(L) no no B MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRSF
MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRSF
#
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 MET .
1 2 GLY .
1 3 ASP .
1 4 PRO .
1 5 GLU .
1 6 ARG .
1 7 PRO .
1 8 GLU .
1 9 ALA .
1 10 ALA .
1 11 GLY .
1 12 LEU .
1 13 ASP .
1 14 GLN .
1 15 ASP .
1 16 GLU .
1 17 ARG .
1 18 SER .
1 19 SER .
1 20 SER .
1 21 ASP .
1 22 THR .
1 23 ASN .
1 24 GLU .
1 25 SER .
1 26 GLU .
1 27 ILE .
1 28 LYS .
1 29 SER .
1 30 ASN .
1 31 GLU .
1 32 GLU .
1 33 PRO .
1 34 LEU .
1 35 LEU .
1 36 ARG .
1 37 LYS .
1 38 SER .
1 39 SER .
1 40 ARG .
1 41 ARG .
1 42 SER .
1 43 PHE .
#
#
loop_
_struct_asym.id
_struct_asym.entity_id
_struct_asym.details
A 1 .
#
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
A 1 1 MET 1 ? ? ? B .
A 1 2 GLY 2 ? ? ? B .
A 1 3 ASP 3 ? ? ? B .
A 1 4 PRO 4 ? ? ? B .
A 1 5 GLU 5 ? ? ? B .
A 1 6 ARG 6 ? ? ? B .
A 1 7 PRO 7 ? ? ? B .
A 1 8 GLU 8 ? ? ? B .
A 1 9 ALA 9 ? ? ? B .
A 1 10 ALA 10 ? ? ? B .
A 1 11 GLY 11 ? ? ? B .
A 1 12 LEU 12 ? ? ? B .
A 1 13 ASP 13 ? ? ? B .
A 1 14 GLN 14 ? ? ? B .
A 1 15 ASP 15 ? ? ? B .
A 1 16 GLU 16 ? ? ? B .
A 1 17 ARG 17 ? ? ? B .
A 1 18 SER 18 ? ? ? B .
A 1 19 SER 19 ? ? ? B .
A 1 20 SER 20 ? ? ? B .
A 1 21 ASP 21 ? ? ? B .
A 1 22 THR 22 ? ? ? B .
A 1 23 ASN 23 ? ? ? B .
A 1 24 GLU 24 ? ? ? B .
A 1 25 SER 25 ? ? ? B .
A 1 26 GLU 26 ? ? ? B .
A 1 27 ILE 27 27 ILE ILE B .
A 1 28 LYS 28 28 LYS LYS B .
A 1 29 SER 29 29 SER SER B .
A 1 30 ASN 30 30 ASN ASN B .
A 1 31 GLU 31 31 GLU GLU B .
A 1 32 GLU 32 32 GLU GLU B .
A 1 33 PRO 33 33 PRO PRO B .
A 1 34 LEU 34 34 LEU LEU B .
A 1 35 LEU 35 35 LEU LEU B .
A 1 36 ARG 36 36 ARG ARG B .
A 1 37 LYS 37 37 LYS LYS B .
A 1 38 SER 38 38 SER SER B .
A 1 39 SER 39 39 SER SER B .
A 1 40 ARG 40 40 ARG ARG B .
A 1 41 ARG 41 41 ARG ARG B .
A 1 42 SER 42 ? ? ? B .
A 1 43 PHE 43 ? ? ? B .
#
#
loop_
_ma_data.id
_ma_data.name
_ma_data.content_type
_ma_data.content_type_other_details
1
'Ribonucleoside-diphosphate reductase subunit M2 B {PDB ID=4djn, label_asym_id=B, auth_asym_id=B, SMTL ID=4djn.1.B}'
'template structure' .
2 . target .
3 'Target-template alignment by HHblits to 4djn, label_asym_id=B'
'target-template alignment' .
4 'model 1' 'model coordinates' .
5 SMTL 'reference database' .
6 PDB 'reference database' .
7 'Template search output' other 'Results of the sequence search'
#
#
loop_
_ma_data_group.ordinal_id
_ma_data_group.group_id
_ma_data_group.data_id
1 1 2
2 1 5
3 1 6
4 2 7
5 3 2
6 3 1
7 3 3
8 4 1
9 4 3
10 5 4
#
#
loop_
_ma_data_ref_db.data_id
_ma_data_ref_db.name
_ma_data_ref_db.location_url
_ma_data_ref_db.version
_ma_data_ref_db.release_date
5 SMTL https://swissmodel.expasy.org/templates/ . 2025-01-01
6 PDB https://www.wwpdb.org . 2024-12-27
#
#
loop_
_ma_target_entity.entity_id
_ma_target_entity.data_id
_ma_target_entity.origin
1 2 'reference database'
#
#
loop_
_ma_target_entity_instance.asym_id
_ma_target_entity_instance.entity_id
_ma_target_entity_instance.details
A 1 .
#
#
loop_
_ma_template_trans_matrix.id
_ma_template_trans_matrix.rot_matrix[1][1]
_ma_template_trans_matrix.rot_matrix[2][1]
_ma_template_trans_matrix.rot_matrix[3][1]
_ma_template_trans_matrix.rot_matrix[1][2]
_ma_template_trans_matrix.rot_matrix[2][2]
_ma_template_trans_matrix.rot_matrix[3][2]
_ma_template_trans_matrix.rot_matrix[1][3]
_ma_template_trans_matrix.rot_matrix[2][3]
_ma_template_trans_matrix.rot_matrix[3][3]
_ma_template_trans_matrix.tr_vector[1]
_ma_template_trans_matrix.tr_vector[2]
_ma_template_trans_matrix.tr_vector[3]
1 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000
1.000000 0 0 0
#
#
loop_
_ma_template_details.ordinal_id
_ma_template_details.template_id
_ma_template_details.template_origin
_ma_template_details.template_entity_type
_ma_template_details.template_trans_matrix_id
_ma_template_details.template_data_id
_ma_template_details.target_asym_id
_ma_template_details.template_label_asym_id
_ma_template_details.template_label_entity_id
_ma_template_details.template_model_num
_ma_template_details.template_auth_asym_id
1 1 'reference database' polymer 1 1 A B 1 1 B
#
#
loop_
_ma_template_poly.template_id
_ma_template_poly.seq_one_letter_code
_ma_template_poly.seq_one_letter_code_can
1
;GDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKL
KADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKK
REFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSN
ELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVAD
RLLVELGFSKVFQAENPFDFMENISLEGKTN
;

;GDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKL
KADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKK
REFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSN
ELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVAD
RLLVELGFSKVFQAENPFDFMENISLEGKTN
;

#
#
loop_
_ma_template_poly_segment.id
_ma_template_poly_segment.template_id
_ma_template_poly_segment.residue_number_begin
_ma_template_poly_segment.residue_number_end
1 1 2 30
#
#
loop_
_ma_template_ref_db_details.template_id
_ma_template_ref_db_details.db_name
_ma_template_ref_db_details.db_name_other_details
_ma_template_ref_db_details.db_accession_code
_ma_template_ref_db_details.db_version_date
1 PDB . 4djn 2024-10-30
#
#
loop_
_ma_target_template_poly_mapping.id
_ma_target_template_poly_mapping.template_segment_id
_ma_target_template_poly_mapping.target_asym_id
_ma_target_template_poly_mapping.target_seq_id_begin
_ma_target_template_poly_mapping.target_seq_id_end
1 1 A 1 43
#
#
loop_
_ma_alignment_info.alignment_id
_ma_alignment_info.data_id
_ma_alignment_info.software_group_id
_ma_alignment_info.alignment_length
_ma_alignment_info.alignment_type
_ma_alignment_info.alignment_mode
1 3 1 43 'target-template pairwise alignment' local
#
#
loop_
_ma_alignment_details.ordinal_id
_ma_alignment_details.alignment_id
_ma_alignment_details.template_segment_id
_ma_alignment_details.target_asym_id
_ma_alignment_details.score_type
_ma_alignment_details.score_type_other_details
_ma_alignment_details.score_value
_ma_alignment_details.percent_sequence_identity
_ma_alignment_details.sequence_identity_denominator
_ma_alignment_details.sequence_identity_denominator_other_details
1 1 1 A 'HHblits e-value' . 0.00016 100.000
'Number of aligned residue pairs (not including the gaps)' .
#
#
loop_
_ma_alignment.ordinal_id
_ma_alignment.alignment_id
_ma_alignment.target_template_flag
_ma_alignment.sequence
1 1 1 MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRSF
2 1 2 ------------DQDERSSSDTNESEIKSNEEPLLRKSSRR--
#
#
loop_
_ma_protocol_step.ordinal_id
_ma_protocol_step.protocol_id
_ma_protocol_step.step_id
_ma_protocol_step.method_type
_ma_protocol_step.step_name
_ma_protocol_step.details
_ma_protocol_step.software_group_id
_ma_protocol_step.input_data_group_id
_ma_protocol_step.output_data_group_id
1 1 1 'template search' 'template search' 'SWISS-MODEL template search in PDB' 2
1 2
2 1 2 'template selection' 'template selection'
'Automatic template selection by SWISS-MODEL {QSQE=0.000}' 3 2 4
3 1 3 modeling 'homology modeling'
'SWISS-MODEL auto-model mode using ProMod3 on 4djn.1, oligomeric state (monomer) as predicted'
4 3 5
#
#
loop_
_ma_model_list.ordinal_id
_ma_model_list.model_id
_ma_model_list.model_group_id
_ma_model_list.model_name
_ma_model_list.model_group_name
_ma_model_list.data_id
_ma_model_list.model_type
_ma_model_list.model_type_other_details
1 1 1 'model 1' . 4 'Homology model' .
#
#
loop_
_atom_site.group_PDB
_atom_site.id
_atom_site.type_symbol
_atom_site.label_atom_id
_atom_site.label_alt_id
_atom_site.label_comp_id
_atom_site.label_seq_id
_atom_site.auth_seq_id
_atom_site.pdbx_PDB_ins_code
_atom_site.label_asym_id
_atom_site.Cartn_x
_atom_site.Cartn_y
_atom_site.Cartn_z
_atom_site.occupancy
_atom_site.label_entity_id
_atom_site.auth_asym_id
_atom_site.auth_comp_id
_atom_site.B_iso_or_equiv
_atom_site.pdbx_PDB_model_num
ATOM 1 N N . ILE 27 27 ? A 19.517 43.751 101.174 1 1 B ILE 0.580 1
ATOM 2 C CA . ILE 27 27 ? A 20.627 44.245 100.266 1 1 B ILE 0.580 1
ATOM 3 C C . ILE 27 27 ? A 20.079 45.233 99.236 1 1 B ILE 0.580 1
ATOM 4 O O . ILE 27 27 ? A 18.911 45.591 99.365 1 1 B ILE 0.580 1
ATOM 5 C CB . ILE 27 27 ? A 21.397 43.046 99.654 1 1 B ILE 0.580 1
ATOM 6 C CG1 . ILE 27 27 ? A 22.909 43.360 99.514 1 1 B ILE 0.580 1
ATOM 7 C CG2 . ILE 27 27 ? A 20.780 42.455 98.349 1 1 B ILE 0.580 1
ATOM 8 C CD1 . ILE 27 27 ? A 23.627 43.453 100.873 1 1 B ILE 0.580 1
ATOM 9 N N . LYS 28 28 ? A 20.836 45.674 98.196 1 1 B LYS 0.630 1
ATOM 10 C CA . LYS 28 28 ? A 20.404 46.551 97.111 1 1 B LYS 0.630 1
ATOM 11 C C . LYS 28 28 ? A 19.125 46.117 96.378 1 1 B LYS 0.630 1
ATOM 12 O O . LYS 28 28 ? A 18.377 46.921 95.864 1 1 B LYS 0.630 1
ATOM 13 C CB . LYS 28 28 ? A 21.559 46.710 96.081 1 1 B LYS 0.630 1
ATOM 14 C CG . LYS 28 28 ? A 22.138 45.389 95.524 1 1 B LYS 0.630 1
ATOM 15 C CD . LYS 28 28 ? A 22.988 45.641 94.262 1 1 B LYS 0.630 1
ATOM 16 C CE . LYS 28 28 ? A 23.994 44.525 93.920 1 1 B LYS 0.630 1
ATOM 17 N NZ . LYS 28 28 ? A 23.584 43.750 92.723 1 1 B LYS 0.630 1
ATOM 18 N N . SER 29 29 ? A 18.801 44.799 96.362 1 1 B SER 0.590 1
ATOM 19 C CA . SER 29 29 ? A 17.603 44.297 95.713 1 1 B SER 0.590 1
ATOM 20 C C . SER 29 29 ? A 16.316 44.613 96.478 1 1 B SER 0.590 1
ATOM 21 O O . SER 29 29 ? A 15.241 44.541 95.914 1 1 B SER 0.590 1
ATOM 22 C CB . SER 29 29 ? A 17.705 42.777 95.382 1 1 B SER 0.590 1
ATOM 23 O OG . SER 29 29 ? A 17.969 41.920 96.493 1 1 B SER 0.590 1
ATOM 24 N N . ASN 30 30 ? A 16.402 45.031 97.771 1 1 B ASN 0.560 1
ATOM 25 C CA . ASN 30 30 ? A 15.260 45.474 98.570 1 1 B ASN 0.560 1
ATOM 26 C C . ASN 30 30 ? A 14.693 46.814 98.111 1 1 B ASN 0.560 1
ATOM 27 O O . ASN 30 30 ? A 13.510 47.098 98.331 1 1 B ASN 0.560 1
ATOM 28 C CB . ASN 30 30 ? A 15.651 45.618 100.071 1 1 B ASN 0.560 1
ATOM 29 C CG . ASN 30 30 ? A 15.610 44.254 100.754 1 1 B ASN 0.560 1
ATOM 30 O OD1 . ASN 30 30 ? A 15.155 43.262 100.242 1 1 B ASN 0.560 1
ATOM 31 N ND2 . ASN 30 30 ? A 16.096 44.233 102.031 1 1 B ASN 0.560 1
ATOM 32 N N . GLU 31 31 ? A 15.542 47.642 97.452 1 1 B GLU 0.540 1
ATOM 33 C CA . GLU 31 31 ? A 15.180 48.900 96.830 1 1 B GLU 0.540 1
ATOM 34 C C . GLU 31 31 ? A 14.200 48.679 95.688 1 1 B GLU 0.540 1
ATOM 35 O O . GLU 31 31 ? A 13.210 49.392 95.575 1 1 B GLU 0.540 1
ATOM 36 C CB . GLU 31 31 ? A 16.434 49.690 96.373 1 1 B GLU 0.540 1
ATOM 37 C CG . GLU 31 31 ? A 16.106 51.116 95.862 1 1 B GLU 0.540 1
ATOM 38 C CD . GLU 31 31 ? A 17.361 51.979 95.757 1 1 B GLU 0.540 1
ATOM 39 O OE1 . GLU 31 31 ? A 18.350 51.522 95.129 1 1 B GLU 0.540 1
ATOM 40 O OE2 . GLU 31 31 ? A 17.342 53.095 96.339 1 1 B GLU 0.540 1
ATOM 41 N N . GLU 32 32 ? A 14.404 47.606 94.887 1 1 B GLU 0.460 1
ATOM 42 C CA . GLU 32 32 ? A 13.596 47.290 93.728 1 1 B GLU 0.460 1
ATOM 43 C C . GLU 32 32 ? A 12.357 46.474 94.116 1 1 B GLU 0.460 1
ATOM 44 O O . GLU 32 32 ? A 12.512 45.361 94.623 1 1 B GLU 0.460 1
ATOM 45 C CB . GLU 32 32 ? A 14.416 46.471 92.691 1 1 B GLU 0.460 1
ATOM 46 C CG . GLU 32 32 ? A 15.515 47.321 92.007 1 1 B GLU 0.460 1
ATOM 47 C CD . GLU 32 32 ? A 14.917 48.317 91.010 1 1 B GLU 0.460 1
ATOM 48 O OE1 . GLU 32 32 ? A 13.666 48.338 90.848 1 1 B GLU 0.460 1
ATOM 49 O OE2 . GLU 32 32 ? A 15.723 49.037 90.374 1 1 B GLU 0.460 1
ATOM 50 N N . PRO 33 33 ? A 11.104 46.901 93.908 1 1 B PRO 0.490 1
ATOM 51 C CA . PRO 33 33 ? A 9.906 46.134 94.257 1 1 B PRO 0.490 1
ATOM 52 C C . PRO 33 33 ? A 9.803 44.773 93.591 1 1 B PRO 0.490 1
ATOM 53 O O . PRO 33 33 ? A 9.220 43.869 94.183 1 1 B PRO 0.490 1
ATOM 54 C CB . PRO 33 33 ? A 8.743 47.035 93.805 1 1 B PRO 0.490 1
ATOM 55 C CG . PRO 33 33 ? A 9.301 48.455 93.935 1 1 B PRO 0.490 1
ATOM 56 C CD . PRO 33 33 ? A 10.784 48.287 93.583 1 1 B PRO 0.490 1
ATOM 57 N N . LEU 34 34 ? A 10.335 44.632 92.357 1 1 B LEU 0.500 1
ATOM 58 C CA . LEU 34 34 ? A 10.399 43.403 91.585 1 1 B LEU 0.500 1
ATOM 59 C C . LEU 34 34 ? A 11.329 42.349 92.180 1 1 B LEU 0.500 1
ATOM 60 O O . LEU 34 34 ? A 11.129 41.162 91.984 1 1 B LEU 0.500 1
ATOM 61 C CB . LEU 34 34 ? A 10.873 43.690 90.132 1 1 B LEU 0.500 1
ATOM 62 C CG . LEU 34 34 ? A 9.837 44.403 89.233 1 1 B LEU 0.500 1
ATOM 63 C CD1 . LEU 34 34 ? A 10.503 44.788 87.901 1 1 B LEU 0.500 1
ATOM 64 C CD2 . LEU 34 34 ? A 8.598 43.524 88.962 1 1 B LEU 0.500 1
ATOM 65 N N . LEU 35 35 ? A 12.399 42.770 92.897 1 1 B LEU 0.500 1
ATOM 66 C CA . LEU 35 35 ? A 13.456 41.860 93.299 1 1 B LEU 0.500 1
ATOM 67 C C . LEU 35 35 ? A 13.536 41.672 94.797 1 1 B LEU 0.500 1
ATOM 68 O O . LEU 35 35 ? A 14.406 40.949 95.295 1 1 B LEU 0.500 1
ATOM 69 C CB . LEU 35 35 ? A 14.829 42.438 92.888 1 1 B LEU 0.500 1
ATOM 70 C CG . LEU 35 35 ? A 15.015 42.704 91.384 1 1 B LEU 0.500 1
ATOM 71 C CD1 . LEU 35 35 ? A 16.415 43.298 91.150 1 1 B LEU 0.500 1
ATOM 72 C CD2 . LEU 35 35 ? A 14.814 41.428 90.544 1 1 B LEU 0.500 1
ATOM 73 N N . ARG 36 36 ? A 12.660 42.330 95.578 1 1 B ARG 0.470 1
ATOM 74 C CA . ARG 36 36 ? A 12.742 42.227 97.015 1 1 B ARG 0.470 1
ATOM 75 C C . ARG 36 36 ? A 12.268 40.874 97.537 1 1 B ARG 0.470 1
ATOM 76 O O . ARG 36 36 ? A 11.154 40.412 97.297 1 1 B ARG 0.470 1
ATOM 77 C CB . ARG 36 36 ? A 12.094 43.428 97.744 1 1 B ARG 0.470 1
ATOM 78 C CG . ARG 36 36 ? A 10.598 43.658 97.459 1 1 B ARG 0.470 1
ATOM 79 C CD . ARG 36 36 ? A 9.907 44.526 98.514 1 1 B ARG 0.470 1
ATOM 80 N NE . ARG 36 36 ? A 10.539 45.895 98.443 1 1 B ARG 0.470 1
ATOM 81 C CZ . ARG 36 36 ? A 9.904 47.049 98.211 1 1 B ARG 0.470 1
ATOM 82 N NH1 . ARG 36 36 ? A 8.602 47.083 97.947 1 1 B ARG 0.470 1
ATOM 83 N NH2 . ARG 36 36 ? A 10.602 48.182 98.225 1 1 B ARG 0.470 1
ATOM 84 N N . LYS 37 37 ? A 13.171 40.166 98.242 1 1 B LYS 0.510 1
ATOM 85 C CA . LYS 37 37 ? A 12.932 38.821 98.720 1 1 B LYS 0.510 1
ATOM 86 C C . LYS 37 37 ? A 11.788 38.694 99.713 1 1 B LYS 0.510 1
ATOM 87 O O . LYS 37 37 ? A 11.656 39.464 100.665 1 1 B LYS 0.510 1
ATOM 88 C CB . LYS 37 37 ? A 14.216 38.205 99.332 1 1 B LYS 0.510 1
ATOM 89 C CG . LYS 37 37 ? A 15.177 37.601 98.291 1 1 B LYS 0.510 1
ATOM 90 C CD . LYS 37 37 ? A 16.494 38.377 98.132 1 1 B LYS 0.510 1
ATOM 91 C CE . LYS 37 37 ? A 17.550 37.574 97.357 1 1 B LYS 0.510 1
ATOM 92 N NZ . LYS 37 37 ? A 18.889 38.178 97.535 1 1 B LYS 0.510 1
ATOM 93 N N . SER 38 38 ? A 10.935 37.674 99.536 1 1 B SER 0.530 1
ATOM 94 C CA . SER 38 38 ? A 9.826 37.462 100.434 1 1 B SER 0.530 1
ATOM 95 C C . SER 38 38 ? A 9.456 35.998 100.424 1 1 B SER 0.530 1
ATOM 96 O O . SER 38 38 ? A 9.769 35.250 99.485 1 1 B SER 0.530 1
ATOM 97 C CB . SER 38 38 ? A 8.599 38.344 100.039 1 1 B SER 0.530 1
ATOM 98 O OG . SER 38 38 ? A 7.468 38.181 100.904 1 1 B SER 0.530 1
ATOM 99 N N . SER 39 39 ? A 8.766 35.573 101.495 1 1 B SER 0.620 1
ATOM 100 C CA . SER 39 39 ? A 8.061 34.311 101.655 1 1 B SER 0.620 1
ATOM 101 C C . SER 39 39 ? A 6.727 34.315 100.929 1 1 B SER 0.620 1
ATOM 102 O O . SER 39 39 ? A 6.110 33.276 100.795 1 1 B SER 0.620 1
ATOM 103 C CB . SER 39 39 ? A 7.744 33.974 103.135 1 1 B SER 0.620 1
ATOM 104 O OG . SER 39 39 ? A 8.941 33.628 103.830 1 1 B SER 0.620 1
ATOM 105 N N . ARG 40 40 ? A 6.249 35.488 100.433 1 1 B ARG 0.620 1
ATOM 106 C CA . ARG 40 40 ? A 5.009 35.595 99.665 1 1 B ARG 0.620 1
ATOM 107 C C . ARG 40 40 ? A 5.237 35.388 98.169 1 1 B ARG 0.620 1
ATOM 108 O O . ARG 40 40 ? A 4.409 35.775 97.352 1 1 B ARG 0.620 1
ATOM 109 C CB . ARG 40 40 ? A 4.388 37.022 99.841 1 1 B ARG 0.620 1
ATOM 110 C CG . ARG 40 40 ? A 2.832 37.110 99.881 1 1 B ARG 0.620 1
ATOM 111 C CD . ARG 40 40 ? A 1.988 37.001 98.590 1 1 B ARG 0.620 1
ATOM 112 N NE . ARG 40 40 ? A 2.314 38.189 97.723 1 1 B ARG 0.620 1
ATOM 113 C CZ . ARG 40 40 ? A 1.743 38.422 96.533 1 1 B ARG 0.620 1
ATOM 114 N NH1 . ARG 40 40 ? A 0.805 37.609 96.065 1 1 B ARG 0.620 1
ATOM 115 N NH2 . ARG 40 40 ? A 2.125 39.455 95.782 1 1 B ARG 0.620 1
ATOM 116 N N . ARG 41 41 ? A 6.396 34.836 97.773 1 1 B ARG 0.510 1
ATOM 117 C CA . ARG 41 41 ? A 6.679 34.559 96.382 1 1 B ARG 0.510 1
ATOM 118 C C . ARG 41 41 ? A 6.131 33.200 95.887 1 1 B ARG 0.510 1
ATOM 119 O O . ARG 41 41 ? A 5.563 32.426 96.700 1 1 B ARG 0.510 1
ATOM 120 C CB . ARG 41 41 ? A 8.200 34.639 96.111 1 1 B ARG 0.510 1
ATOM 121 C CG . ARG 41 41 ? A 9.046 33.401 96.482 1 1 B ARG 0.510 1
ATOM 122 C CD . ARG 41 41 ? A 10.529 33.706 96.267 1 1 B ARG 0.510 1
ATOM 123 N NE . ARG 41 41 ? A 11.347 32.497 96.618 1 1 B ARG 0.510 1
ATOM 124 C CZ . ARG 41 41 ? A 11.785 32.215 97.852 1 1 B ARG 0.510 1
ATOM 125 N NH1 . ARG 41 41 ? A 11.429 32.933 98.909 1 1 B ARG 0.510 1
ATOM 126 N NH2 . ARG 41 41 ? A 12.602 31.175 98.028 1 1 B ARG 0.510 1
ATOM 127 O OXT . ARG 41 41 ? A 6.304 32.932 94.666 1 1 B ARG 0.510 1
#
#
loop_
_atom_type.symbol
C
N
O
#
#
loop_
_ma_qa_metric.id
_ma_qa_metric.name
_ma_qa_metric.description
_ma_qa_metric.type
_ma_qa_metric.mode
_ma_qa_metric.type_other_details
_ma_qa_metric.software_group_id
1 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].'
'pLDDT all-atom in [0,1]' local . 5
2 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].'
'pLDDT all-atom in [0,1]' global . 5
3 GMQE
'Global Model Quality Estimate of the model accuracy, calculated by SWISS-MODEL.'
'normalized score' global . 6
#
#
loop_
_ma_qa_metric_global.ordinal_id
_ma_qa_metric_global.model_id
_ma_qa_metric_global.metric_id
_ma_qa_metric_global.metric_value
1 1 2 0.541
2 1 3 0.269
#
#
loop_
_ma_qa_metric_local.ordinal_id
_ma_qa_metric_local.model_id
_ma_qa_metric_local.label_asym_id
_ma_qa_metric_local.label_seq_id
_ma_qa_metric_local.label_comp_id
_ma_qa_metric_local.metric_id
_ma_qa_metric_local.metric_value
1 1 A 27 ILE 1 0.580
2 1 A 28 LYS 1 0.630
3 1 A 29 SER 1 0.590
4 1 A 30 ASN 1 0.560
5 1 A 31 GLU 1 0.540
6 1 A 32 GLU 1 0.460
7 1 A 33 PRO 1 0.490
8 1 A 34 LEU 1 0.500
9 1 A 35 LEU 1 0.500
10 1 A 36 ARG 1 0.470
11 1 A 37 LYS 1 0.510
12 1 A 38 SER 1 0.530
13 1 A 39 SER 1 0.620
14 1 A 40 ARG 1 0.620
15 1 A 41 ARG 1 0.510
#
#
loop_
_pdbx_data_usage.id
_pdbx_data_usage.type
_pdbx_data_usage.details
_pdbx_data_usage.url
1 license
;This SWISS-MODEL protein model is copyright.
It is produced by the SWISS-MODEL server, developed by the Computational
Structural Biology Group at the SIB Swiss Institute of Bioinformatics at the
Biozentrum, University of Basel (https://swissmodel.expasy.org). This
model is licensed under the CC BY-SA 4.0 Creative Commons
Attribution-ShareAlike 4.0 International License
(https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
can copy and redistribute the model in any medium or format,
transform and build upon the model for any purpose, even
commercially, under the following terms:
Attribution - You must give appropriate credit, provide a link to
the license, and indicate if changes were made. You may do so in any
reasonable manner, but not in any way that suggests the licensor
endorses you or your use. When you publish, patent or distribute
results that were fully or partially based on the model, please cite
the corresponding papers mentioned under JRNL.
ShareAlike - If you remix, transform, or build upon the material,
you must distribute your contributions under the same license as the
original.
No additional restrictions - you may not apply legal terms or
technological measures that legally restrict others from doing
anything the license permits.
Find a human-readable summary of (and not a substitute for) the
CC BY-SA 4.0 license at this link:
https://creativecommons.org/licenses/by-sa/4.0/
;
https://creativecommons.org/licenses/by-sa/4.0/legalcode
2 disclaimer
;The SWISS-MODEL SERVER produces theoretical models for
proteins. The results of any theoretical modelling procedure is
NON-EXPERIMENTAL and MUST be considered with care. These models may
contain significant errors. This is especially true for automated
modeling since there is no human intervention during model
building. Please read the header section and the logfile carefully
to know what templates and alignments were used during the model
building process. All information by the SWISS-MODEL SERVER is
provided "AS-IS", without any warranty, expressed or implied.
;
https://swissmodel.expasy.org/docs/terms_of_use#disclaimer
#