data_SMR-724ee7ac4c5b73ec2c02b5034998d873_1
_entry.id SMR-724ee7ac4c5b73ec2c02b5034998d873_1
_struct.entry_id SMR-724ee7ac4c5b73ec2c02b5034998d873_1
_struct.pdbx_model_details
;This model was generated unsupervised by the SWISS-MODEL homology-modelling pipeline for the SWISS-MODEL Repository, a database of annotated 3D protein structure models. The modelled monomer covers following UniProtKB entries:

  - P86852/ CYCL_CLITE, Cyclotide cter-L

Estimated model accuracy of this model is 0.697, calculated by SWISS-MODEL as Global Model Quality Estimate (GMQE).
;
_struct.pdbx_structure_determination_methodology computational
_struct.title 'Model for UniProtKB entries P86852'
_audit_conform.dict_location https://raw.githubusercontent.com/ihmwg/ModelCIF/d18ba38/base/mmcif_ma-core.dic
_audit_conform.dict_name mmcif_ma.dic
_audit_conform.dict_version 1.4.6
#
loop_
_citation.id
_citation.title
_citation.journal_abbrev
_citation.journal_volume
_citation.page_first
_citation.page_last
_citation.year
_citation.pdbx_database_id_PubMed
_citation.pdbx_database_id_DOI
primary 'The SWISS-MODEL Repository - new features and functionality'
'Nucleic Acids Res.' 45 D313 D319 2017 27899672 10.1093/nar/gkw1132
2 'SWISS-MODEL: homology modelling of protein structures and complexes'
'Nucleic Acids Res.' 46 W296 W303 2018 29788355 10.1093/nar/gky427
3 'ProMod3 - A versatile homology modelling toolbox' 'PLoS Comput. Biol.' 17(1)
1 18 2021 33507980 10.1371/journal.pcbi.1008667
4 'QMEANDisCo - distance constraints applied on model quality estimation'
Bioinformatics 36 1765 1771 2020 31697312 10.1093/bioinformatics/btz828
5
'OpenStructure: an integrated software framework for computational structural biology'
'Acta Crystallogr., Sect. D: Biol. Crystallogr.' 69 701 709 2013 23633579
10.1107/S0907444913007051
6 'BLAST+: architecture and applications' 'BMC Bioinf.' 10 421 . 2009 20003500
10.1186/1471-2105-10-421
7 'HH-suite3 for fast remote homology detection and deep protein annotation'
'BMC Bioinf.' 20 473 . 2019 31521110 10.1186/s12859-019-3019-7
#
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
primary 'Bienert, S.' 1
primary 'Waterhouse, A.' 2
primary 'de Beer, T.A.P.' 3
primary 'Tauriello, G.' 4
primary 'Studer, G.' 5
primary 'Bordoli, L.' 6
primary 'Schwede, T.' 7
2 'Waterhouse, A.' 8
2 'Bertoni, M.' 9
2 'Bienert, S.' 10
2 'Studer, G.' 11
2 'Tauriello, G.' 12
2 'Gumienny, R.' 13
2 'Heer, F.T.' 14
2 'de Beer, T.A.P.' 15
2 'Rempfer, C.' 16
2 'Bordoli, L.' 17
2 'Lepore, R.' 18
2 'Schwede, T.' 19
3 'Studer, G.' 20
3 'Tauriello, G.' 21
3 'Bienert, S.' 22
3 'Biasini, M.' 23
3 'Johner, N.' 24
3 'Schwede, T.' 25
4 'Studer, G.' 26
4 'Rempfer, C.' 27
4 'Waterhouse, A.M.' 28
4 'Gumienny, R.' 29
4 'Haas, J.' 30
4 'Schwede, T.' 31
5 'Biasini, M.' 32
5 'Schmidt, T.' 33
5 'Bienert, S.' 34
5 'Mariani, V.' 35
5 'Studer, G.' 36
5 'Haas, J.' 37
5 'Johner, N.' 38
5 'Schenk, A.D.' 39
5 'Philippsen, A.' 40
5 'Schwede, T.' 41
6 'Camacho, C.' 42
6 'Coulouris, G.' 43
6 'Avagyan, V.' 44
6 'Ma, N.' 45
6 'Papadopoulos, J.' 46
6 'Bealer, K.' 47
6 'Madden, T.L.' 48
7 'Steinegger, M.' 49
7 'Meier, M.' 50
7 'Mirdita, M.' 51
7 'Vohringer, H.' 52
7 'Haunsberger, S.J.' 53
7 'Soding, J.' 54
#
#
loop_
_software.pdbx_ordinal
_software.name
_software.classification
_software.description
_software.version
_software.type
_software.location
_software.citation_id
1 SWISS-MODEL 'model building' 'Homology modelling web service'
c59120ae913c122b22dc2ebae5eb59cce9b022ff package https://swissmodel.expasy.org 2
2 ProMod3 'model building' 'Modular homology modelling engine' 3.4.1 library
https://git.scicore.unibas.ch/schwede/ProMod3 3
3 QMEAN 'model building' 'QMEAN - Qualitative Model Energy ANalysis' 4.3.1
library https://git.scicore.unibas.ch/schwede/QMEAN 4
4 OpenStructure 'data processing'
'Open-Source Computational Structural Biology Framework' 2.8.0 package
https://openstructure.org/ 5
5 BLAST 'data collection' . 2.14.1 package https://blast.ncbi.nlm.nih.gov 6
6 HH-suite 'data collection' 'HH-suite3 for sensitive sequence searching' 3.2.0
package https://github.com/soedinglab/hh-suite 7
#
#
loop_
_ma_software_group.ordinal_id
_ma_software_group.group_id
_ma_software_group.software_id
_ma_software_group.parameter_group_id
1 1 6 .
2 2 1 .
3 2 4 .
4 2 5 .
5 2 6 .
6 3 1 .
7 3 4 .
8 4 1 .
9 4 2 .
10 4 4 .
11 5 3 .
12 6 1 .
13 6 3 .
14 6 4 .
#
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
'Bienert, S.' 1
'Waterhouse, A.' 2
'de Beer, T.A.P.' 3
'Tauriello, G.' 4
'Studer, G.' 5
'Bordoli, L.' 6
'Schwede, T.' 7
#
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.name
_chem_comp.formula
_chem_comp.formula_weight
_chem_comp.ma_provenance
ALA 'L-peptide linking' ALANINE 'C3 H7 N O2' 89.094 'CCD Core'
ARG 'L-peptide linking' ARGININE 'C6 H15 N4 O2 1' 175.212 'CCD Core'
ASN 'L-peptide linking' ASPARAGINE 'C4 H8 N2 O3' 132.119 'CCD Core'
ASP 'L-peptide linking' 'ASPARTIC ACID' 'C4 H7 N O4' 133.103 'CCD Core'
CYS 'L-peptide linking' CYSTEINE 'C3 H7 N O2 S' 121.154 'CCD Core'
GLU 'L-peptide linking' 'GLUTAMIC ACID' 'C5 H9 N O4' 147.130 'CCD Core'
GLY 'peptide linking' GLYCINE 'C2 H5 N O2' 75.067 'CCD Core'
HIS 'L-peptide linking' HISTIDINE 'C6 H10 N3 O2 1' 156.165 'CCD Core'
ILE 'L-peptide linking' ISOLEUCINE 'C6 H13 N O2' 131.175 'CCD Core'
LYS 'L-peptide linking' LYSINE 'C6 H15 N2 O2 1' 147.198 'CCD Core'
PHE 'L-peptide linking' PHENYLALANINE 'C9 H11 N O2' 165.192 'CCD Core'
PRO 'L-peptide linking' PROLINE 'C5 H9 N O2' 115.132 'CCD Core'
SER 'L-peptide linking' SERINE 'C3 H7 N O3' 105.093 'CCD Core'
THR 'L-peptide linking' THREONINE 'C4 H9 N O3' 119.120 'CCD Core'
TRP 'L-peptide linking' TRYPTOPHAN 'C11 H12 N2 O2' 204.229 'CCD Core'
TYR 'L-peptide linking' TYROSINE 'C9 H11 N O3' 181.191 'CCD Core'
VAL 'L-peptide linking' VALINE 'C5 H11 N O2' 117.148 'CCD Core'
#
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.details
1 polymer man . 3643.116 1 .
#
#
loop_
_struct_ref.id
_struct_ref.entity_id
_struct_ref.db_name
_struct_ref.db_code
_struct_ref.pdbx_db_accession
_struct_ref.pdbx_align_begin
_struct_ref.pdbx_seq_one_letter_code
_struct_ref.details
1 1 UNP CYCL_CLITE P86852 1 HEPCGESCVFIPCITTVVGCSCKNKVCYD 'Cyclotide cter-L'
#
#
loop_
_struct_ref_seq.align_id
_struct_ref_seq.ref_id
_struct_ref_seq.seq_align_beg
_struct_ref_seq.seq_align_end
_struct_ref_seq.db_align_beg
_struct_ref_seq.db_align_end
1 1 1 29 1 29
#
#
loop_
_ma_target_ref_db_details.target_entity_id
_ma_target_ref_db_details.db_name
_ma_target_ref_db_details.db_name_other_details
_ma_target_ref_db_details.db_code
_ma_target_ref_db_details.db_accession
_ma_target_ref_db_details.seq_db_isoform
_ma_target_ref_db_details.seq_db_align_begin
_ma_target_ref_db_details.seq_db_align_end
_ma_target_ref_db_details.ncbi_taxonomy_id
_ma_target_ref_db_details.organism_scientific
_ma_target_ref_db_details.seq_db_sequence_version_date
_ma_target_ref_db_details.seq_db_sequence_checksum
1 UNP . CYCL_CLITE P86852 . 1 29 43366 'Clitoria ternatea (Butterfly pea)'
2011-03-08 1F3A52E2DF8F3786
#
#
loop_
_entity_poly.entity_id
_entity_poly.type
_entity_poly.nstd_linkage
_entity_poly.nstd_monomer
_entity_poly.pdbx_strand_id
_entity_poly.pdbx_seq_one_letter_code
_entity_poly.pdbx_seq_one_letter_code_can
1 polypeptide(L) no no A HEPCGESCVFIPCITTVVGCSCKNKVCYD
HEPCGESCVFIPCITTVVGCSCKNKVCYD
#
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 HIS .
1 2 GLU .
1 3 PRO .
1 4 CYS .
1 5 GLY .
1 6 GLU .
1 7 SER .
1 8 CYS .
1 9 VAL .
1 10 PHE .
1 11 ILE .
1 12 PRO .
1 13 CYS .
1 14 ILE .
1 15 THR .
1 16 THR .
1 17 VAL .
1 18 VAL .
1 19 GLY .
1 20 CYS .
1 21 SER .
1 22 CYS .
1 23 LYS .
1 24 ASN .
1 25 LYS .
1 26 VAL .
1 27 CYS .
1 28 TYR .
1 29 ASP .
#
#
loop_
_struct_asym.id
_struct_asym.entity_id
_struct_asym.details
A 1 .
#
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
A 1 1 HIS 1 ? ? ? A .
A 1 2 GLU 2 2 GLU GLU A .
A 1 3 PRO 3 3 PRO PRO A .
A 1 4 CYS 4 4 CYS CYS A .
A 1 5 GLY 5 5 GLY GLY A .
A 1 6 GLU 6 6 GLU GLU A .
A 1 7 SER 7 7 SER SER A .
A 1 8 CYS 8 8 CYS CYS A .
A 1 9 VAL 9 9 VAL VAL A .
A 1 10 PHE 10 10 PHE PHE A .
A 1 11 ILE 11 11 ILE ILE A .
A 1 12 PRO 12 12 PRO PRO A .
A 1 13 CYS 13 13 CYS CYS A .
A 1 14 ILE 14 14 ILE ILE A .
A 1 15 THR 15 15 THR THR A .
A 1 16 THR 16 16 THR THR A .
A 1 17 VAL 17 17 VAL VAL A .
A 1 18 VAL 18 18 VAL VAL A .
A 1 19 GLY 19 19 GLY GLY A .
A 1 20 CYS 20 20 CYS CYS A .
A 1 21 SER 21 21 SER SER A .
A 1 22 CYS 22 22 CYS CYS A .
A 1 23 LYS 23 23 LYS LYS A .
A 1 24 ASN 24 24 ASN ASN A .
A 1 25 LYS 25 25 LYS LYS A .
A 1 26 VAL 26 26 VAL VAL A .
A 1 27 CYS 27 27 CYS CYS A .
A 1 28 TYR 28 28 TYR TYR A .
A 1 29 ASP 29 29 ASP ASP A .
#
#
loop_
_ma_data.id
_ma_data.name
_ma_data.content_type
_ma_data.content_type_other_details
1
'Cycloviolacin O2 {PDB ID=7rmq, label_asym_id=A, auth_asym_id=A, SMTL ID=7rmq.1.A}'
'template structure' .
2 . target .
3 'Target-template alignment by HHblits to 7rmq, label_asym_id=A'
'target-template alignment' .
4 'model 1' 'model coordinates' .
5 SMTL 'reference database' .
6 PDB 'reference database' .
7 'Template search output' other 'Results of the sequence search'
#
#
loop_
_ma_data_group.ordinal_id
_ma_data_group.group_id
_ma_data_group.data_id
1 1 2
2 1 5
3 1 6
4 2 7
5 3 2
6 3 1
7 3 3
8 4 1
9 4 3
10 5 4
#
#
loop_
_ma_data_ref_db.data_id
_ma_data_ref_db.name
_ma_data_ref_db.location_url
_ma_data_ref_db.version
_ma_data_ref_db.release_date
5 SMTL https://swissmodel.expasy.org/templates/ . 2025-05-01
6 PDB https://www.wwpdb.org . 2025-05-01
#
#
loop_
_ma_target_entity.entity_id
_ma_target_entity.data_id
_ma_target_entity.origin
1 2 'reference database'
#
#
loop_
_ma_target_entity_instance.asym_id
_ma_target_entity_instance.entity_id
_ma_target_entity_instance.details
A 1 .
#
#
loop_
_ma_template_trans_matrix.id
_ma_template_trans_matrix.rot_matrix[1][1]
_ma_template_trans_matrix.rot_matrix[2][1]
_ma_template_trans_matrix.rot_matrix[3][1]
_ma_template_trans_matrix.rot_matrix[1][2]
_ma_template_trans_matrix.rot_matrix[2][2]
_ma_template_trans_matrix.rot_matrix[3][2]
_ma_template_trans_matrix.rot_matrix[1][3]
_ma_template_trans_matrix.rot_matrix[2][3]
_ma_template_trans_matrix.rot_matrix[3][3]
_ma_template_trans_matrix.tr_vector[1]
_ma_template_trans_matrix.tr_vector[2]
_ma_template_trans_matrix.tr_vector[3]
1 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000
1.000000 0 0 0
#
#
loop_
_ma_template_details.ordinal_id
_ma_template_details.template_id
_ma_template_details.template_origin
_ma_template_details.template_entity_type
_ma_template_details.template_trans_matrix_id
_ma_template_details.template_data_id
_ma_template_details.target_asym_id
_ma_template_details.template_label_asym_id
_ma_template_details.template_label_entity_id
_ma_template_details.template_model_num
_ma_template_details.template_auth_asym_id
1 1 'reference database' polymer 1 1 A A 1 1 A
#
#
loop_
_ma_template_poly.template_id
_ma_template_poly.seq_one_letter_code
_ma_template_poly.seq_one_letter_code_can
1 IPCGESCVWIPCISSAIGCSCKSKVCYRNG IPCGESCVWIPCISSAIGCSCKSKVCYRNG
#
#
loop_
_ma_template_poly_segment.id
_ma_template_poly_segment.template_id
_ma_template_poly_segment.residue_number_begin
_ma_template_poly_segment.residue_number_end
1 1 1 28
#
#
loop_
_ma_template_ref_db_details.template_id
_ma_template_ref_db_details.db_name
_ma_template_ref_db_details.db_name_other_details
_ma_template_ref_db_details.db_accession_code
_ma_template_ref_db_details.db_version_date
1 PDB . 7rmq 2024-10-23
#
#
loop_
_ma_target_template_poly_mapping.id
_ma_target_template_poly_mapping.template_segment_id
_ma_target_template_poly_mapping.target_asym_id
_ma_target_template_poly_mapping.target_seq_id_begin
_ma_target_template_poly_mapping.target_seq_id_end
1 1 A 1 29
#
#
loop_
_ma_alignment_info.alignment_id
_ma_alignment_info.data_id
_ma_alignment_info.software_group_id
_ma_alignment_info.alignment_length
_ma_alignment_info.alignment_type
_ma_alignment_info.alignment_mode
1 3 1 29 'target-template pairwise alignment' local
#
#
loop_
_ma_alignment_details.ordinal_id
_ma_alignment_details.alignment_id
_ma_alignment_details.template_segment_id
_ma_alignment_details.target_asym_id
_ma_alignment_details.score_type
_ma_alignment_details.score_type_other_details
_ma_alignment_details.score_value
_ma_alignment_details.percent_sequence_identity
_ma_alignment_details.sequence_identity_denominator
_ma_alignment_details.sequence_identity_denominator_other_details
1 1 1 A 'HHblits e-value' . 2.4e-17 71.429
'Number of aligned residue pairs (not including the gaps)' .
#
#
loop_
_ma_alignment.ordinal_id
_ma_alignment.alignment_id
_ma_alignment.target_template_flag
_ma_alignment.sequence
1 1 1 HEPCGESCVFIPCITTVVGCSCKNKVCYD
2 1 2 -IPCGESCVWIPCISSAIGCSCKSKVCYR
#
#
loop_
_ma_protocol_step.ordinal_id
_ma_protocol_step.protocol_id
_ma_protocol_step.step_id
_ma_protocol_step.method_type
_ma_protocol_step.step_name
_ma_protocol_step.details
_ma_protocol_step.software_group_id
_ma_protocol_step.input_data_group_id
_ma_protocol_step.output_data_group_id
1 1 1 'template search' 'template search' 'SWISS-MODEL template search in PDB' 2
1 2
2 1 2 'template selection' 'template selection'
'Automatic template selection by SWISS-MODEL {QSQE=0.000}' 3 2 4
3 1 3 modeling 'homology modeling'
'SWISS-MODEL auto-model mode using ProMod3 on 7rmq.1' 4 3 5
#
#
loop_
_ma_model_list.ordinal_id
_ma_model_list.model_id
_ma_model_list.model_group_id
_ma_model_list.model_name
_ma_model_list.model_group_name
_ma_model_list.data_id
_ma_model_list.model_type
_ma_model_list.model_type_other_details
1 1 1 'model 1' . 4 'Homology model' .
#
#
loop_
_atom_site.group_PDB
_atom_site.id
_atom_site.type_symbol
_atom_site.label_atom_id
_atom_site.label_alt_id
_atom_site.label_comp_id
_atom_site.label_seq_id
_atom_site.auth_seq_id
_atom_site.pdbx_PDB_ins_code
_atom_site.label_asym_id
_atom_site.Cartn_x
_atom_site.Cartn_y
_atom_site.Cartn_z
_atom_site.occupancy
_atom_site.label_entity_id
_atom_site.auth_asym_id
_atom_site.auth_comp_id
_atom_site.B_iso_or_equiv
_atom_site.pdbx_PDB_model_num
ATOM 1 N N . GLU 2 2 ? A 8.963 -3.053 -1.602 1 1 A GLU 0.420 1
ATOM 2 C CA . GLU 2 2 ? A 10.115 -2.225 -1.146 1 1 A GLU 0.420 1
ATOM 3 C C . GLU 2 2 ? A 9.966 -1.713 0.289 1 1 A GLU 0.420 1
ATOM 4 O O . GLU 2 2 ? A 8.908 -1.175 0.594 1 1 A GLU 0.420 1
ATOM 5 C CB . GLU 2 2 ? A 10.247 -1.039 -2.112 1 1 A GLU 0.420 1
ATOM 6 C CG . GLU 2 2 ? A 11.517 -0.194 -1.868 1 1 A GLU 0.420 1
ATOM 7 C CD . GLU 2 2 ? A 11.758 0.857 -2.956 1 1 A GLU 0.420 1
ATOM 8 O OE1 . GLU 2 2 ? A 12.764 1.595 -2.817 1 1 A GLU 0.420 1
ATOM 9 O OE2 . GLU 2 2 ? A 10.978 0.890 -3.940 1 1 A GLU 0.420 1
ATOM 10 N N . PRO 3 3 ? A 10.890 -1.873 1.239 1 1 A PRO 0.440 1
ATOM 11 C CA . PRO 3 3 ? A 10.731 -1.352 2.599 1 1 A PRO 0.440 1
ATOM 12 C C . PRO 3 3 ? A 10.903 0.161 2.627 1 1 A PRO 0.440 1
ATOM 13 O O . PRO 3 3 ? A 11.807 0.682 1.982 1 1 A PRO 0.440 1
ATOM 14 C CB . PRO 3 3 ? A 11.821 -2.083 3.409 1 1 A PRO 0.440 1
ATOM 15 C CG . PRO 3 3 ? A 12.891 -2.449 2.377 1 1 A PRO 0.440 1
ATOM 16 C CD . PRO 3 3 ? A 12.101 -2.671 1.091 1 1 A PRO 0.440 1
ATOM 17 N N . CYS 4 4 ? A 10.061 0.893 3.383 1 1 A CYS 0.780 1
ATOM 18 C CA . CYS 4 4 ? A 9.985 2.343 3.290 1 1 A CYS 0.780 1
ATOM 19 C C . CYS 4 4 ? A 10.806 3.100 4.321 1 1 A CYS 0.780 1
ATOM 20 O O . CYS 4 4 ? A 10.798 4.323 4.368 1 1 A CYS 0.780 1
ATOM 21 C CB . CYS 4 4 ? A 8.520 2.793 3.457 1 1 A CYS 0.780 1
ATOM 22 S SG . CYS 4 4 ? A 7.482 2.135 2.127 1 1 A CYS 0.780 1
ATOM 23 N N . GLY 5 5 ? A 11.532 2.371 5.190 1 1 A GLY 0.800 1
ATOM 24 C CA . GLY 5 5 ? A 12.337 2.978 6.244 1 1 A GLY 0.800 1
ATOM 25 C C . GLY 5 5 ? A 11.613 3.143 7.551 1 1 A GLY 0.800 1
ATOM 26 O O . GLY 5 5 ? A 11.876 4.075 8.295 1 1 A GLY 0.800 1
ATOM 27 N N . GLU 6 6 ? A 10.694 2.221 7.882 1 1 A GLU 0.770 1
ATOM 28 C CA . GLU 6 6 ? A 9.962 2.271 9.129 1 1 A GLU 0.770 1
ATOM 29 C C . GLU 6 6 ? A 9.607 0.835 9.500 1 1 A GLU 0.770 1
ATOM 30 O O . GLU 6 6 ? A 9.434 -0.013 8.624 1 1 A GLU 0.770 1
ATOM 31 C CB . GLU 6 6 ? A 8.698 3.160 8.989 1 1 A GLU 0.770 1
ATOM 32 C CG . GLU 6 6 ? A 7.886 3.377 10.286 1 1 A GLU 0.770 1
ATOM 33 C CD . GLU 6 6 ? A 6.579 4.132 10.061 1 1 A GLU 0.770 1
ATOM 34 O OE1 . GLU 6 6 ? A 6.189 4.373 8.887 1 1 A GLU 0.770 1
ATOM 35 O OE2 . GLU 6 6 ? A 5.916 4.469 11.070 1 1 A GLU 0.770 1
ATOM 36 N N . SER 7 7 ? A 9.512 0.501 10.806 1 1 A SER 0.790 1
ATOM 37 C CA . SER 7 7 ? A 9.008 -0.782 11.281 1 1 A SER 0.790 1
ATOM 38 C C . SER 7 7 ? A 7.694 -0.546 11.987 1 1 A SER 0.790 1
ATOM 39 O O . SER 7 7 ? A 7.389 0.568 12.398 1 1 A SER 0.790 1
ATOM 40 C CB . SER 7 7 ? A 9.967 -1.588 12.218 1 1 A SER 0.790 1
ATOM 41 O OG . SER 7 7 ? A 10.151 -0.984 13.503 1 1 A SER 0.790 1
ATOM 42 N N . CYS 8 8 ? A 6.864 -1.592 12.141 1 1 A CYS 0.760 1
ATOM 43 C CA . CYS 8 8 ? A 5.509 -1.434 12.642 1 1 A CYS 0.760 1
ATOM 44 C C . CYS 8 8 ? A 5.146 -2.514 13.642 1 1 A CYS 0.760 1
ATOM 45 O O . CYS 8 8 ? A 4.057 -3.081 13.633 1 1 A CYS 0.760 1
ATOM 46 C CB . CYS 8 8 ? A 4.487 -1.379 11.484 1 1 A CYS 0.760 1
ATOM 47 S SG . CYS 8 8 ? A 4.757 -2.692 10.256 1 1 A CYS 0.760 1
ATOM 48 N N . VAL 9 9 ? A 6.091 -2.833 14.550 1 1 A VAL 0.610 1
ATOM 49 C CA . VAL 9 9 ? A 5.842 -3.718 15.683 1 1 A VAL 0.610 1
ATOM 50 C C . VAL 9 9 ? A 5.106 -3.003 16.802 1 1 A VAL 0.610 1
ATOM 51 O O . VAL 9 9 ? A 4.121 -3.493 17.336 1 1 A VAL 0.610 1
ATOM 52 C CB . VAL 9 9 ? A 7.140 -4.300 16.240 1 1 A VAL 0.610 1
ATOM 53 C CG1 . VAL 9 9 ? A 6.892 -5.169 17.493 1 1 A VAL 0.610 1
ATOM 54 C CG2 . VAL 9 9 ? A 7.786 -5.152 15.139 1 1 A VAL 0.610 1
ATOM 55 N N . PHE 10 10 ? A 5.590 -1.800 17.176 1 1 A PHE 0.480 1
ATOM 56 C CA . PHE 10 10 ? A 5.003 -1.020 18.247 1 1 A PHE 0.480 1
ATOM 57 C C . PHE 10 10 ? A 3.760 -0.255 17.826 1 1 A PHE 0.480 1
ATOM 58 O O . PHE 10 10 ? A 2.788 -0.187 18.564 1 1 A PHE 0.480 1
ATOM 59 C CB . PHE 10 10 ? A 6.011 0.004 18.824 1 1 A PHE 0.480 1
ATOM 60 C CG . PHE 10 10 ? A 7.161 -0.687 19.493 1 1 A PHE 0.480 1
ATOM 61 C CD1 . PHE 10 10 ? A 6.994 -1.225 20.777 1 1 A PHE 0.480 1
ATOM 62 C CD2 . PHE 10 10 ? A 8.415 -0.791 18.871 1 1 A PHE 0.480 1
ATOM 63 C CE1 . PHE 10 10 ? A 8.058 -1.855 21.431 1 1 A PHE 0.480 1
ATOM 64 C CE2 . PHE 10 10 ? A 9.480 -1.426 19.521 1 1 A PHE 0.480 1
ATOM 65 C CZ . PHE 10 10 ? A 9.302 -1.956 20.803 1 1 A PHE 0.480 1
ATOM 66 N N . ILE 11 11 ? A 3.781 0.359 16.626 1 1 A ILE 0.570 1
ATOM 67 C CA . ILE 11 11 ? A 2.782 1.324 16.184 1 1 A ILE 0.570 1
ATOM 68 C C . ILE 11 11 ? A 2.576 1.059 14.690 1 1 A ILE 0.570 1
ATOM 69 O O . ILE 11 11 ? A 3.514 0.572 14.061 1 1 A ILE 0.570 1
ATOM 70 C CB . ILE 11 11 ? A 3.253 2.756 16.521 1 1 A ILE 0.570 1
ATOM 71 C CG1 . ILE 11 11 ? A 3.146 3.063 18.036 1 1 A ILE 0.570 1
ATOM 72 C CG2 . ILE 11 11 ? A 2.601 3.915 15.740 1 1 A ILE 0.570 1
ATOM 73 C CD1 . ILE 11 11 ? A 1.733 2.940 18.615 1 1 A ILE 0.570 1
ATOM 74 N N . PRO 12 12 ? A 1.408 1.262 14.063 1 1 A PRO 0.760 1
ATOM 75 C CA . PRO 12 12 ? A 1.229 1.246 12.609 1 1 A PRO 0.760 1
ATOM 76 C C . PRO 12 12 ? A 2.145 2.176 11.843 1 1 A PRO 0.760 1
ATOM 77 O O . PRO 12 12 ? A 2.744 3.065 12.426 1 1 A PRO 0.760 1
ATOM 78 C CB . PRO 12 12 ? A -0.238 1.657 12.402 1 1 A PRO 0.760 1
ATOM 79 C CG . PRO 12 12 ? A -0.926 1.292 13.714 1 1 A PRO 0.760 1
ATOM 80 C CD . PRO 12 12 ? A 0.159 1.580 14.745 1 1 A PRO 0.760 1
ATOM 81 N N . CYS 13 13 ? A 2.239 1.997 10.516 1 1 A CYS 0.770 1
ATOM 82 C CA . CYS 13 13 ? A 3.114 2.786 9.677 1 1 A CYS 0.770 1
ATOM 83 C C . CYS 13 13 ? A 2.649 4.220 9.555 1 1 A CYS 0.770 1
ATOM 84 O O . CYS 13 13 ? A 1.529 4.482 9.129 1 1 A CYS 0.770 1
ATOM 85 C CB . CYS 13 13 ? A 3.220 2.129 8.279 1 1 A CYS 0.770 1
ATOM 86 S SG . CYS 13 13 ? A 3.898 0.457 8.388 1 1 A CYS 0.770 1
ATOM 87 N N . ILE 14 14 ? A 3.503 5.198 9.891 1 1 A ILE 0.740 1
ATOM 88 C CA . ILE 14 14 ? A 3.313 6.612 9.624 1 1 A ILE 0.740 1
ATOM 89 C C . ILE 14 14 ? A 3.576 6.846 8.145 1 1 A ILE 0.740 1
ATOM 90 O O . ILE 14 14 ? A 2.913 7.647 7.498 1 1 A ILE 0.740 1
ATOM 91 C CB . ILE 14 14 ? A 4.150 7.512 10.545 1 1 A ILE 0.740 1
ATOM 92 C CG1 . ILE 14 14 ? A 3.602 7.491 12.000 1 1 A ILE 0.740 1
ATOM 93 C CG2 . ILE 14 14 ? A 4.208 8.977 10.036 1 1 A ILE 0.740 1
ATOM 94 C CD1 . ILE 14 14 ? A 4.107 6.341 12.879 1 1 A ILE 0.740 1
ATOM 95 N N . THR 15 15 ? A 4.494 6.062 7.531 1 1 A THR 0.710 1
ATOM 96 C CA . THR 15 15 ? A 4.687 5.994 6.081 1 1 A THR 0.710 1
ATOM 97 C C . THR 15 15 ? A 3.473 5.562 5.246 1 1 A THR 0.710 1
ATOM 98 O O . THR 15 15 ? A 3.539 5.564 4.016 1 1 A THR 0.710 1
ATOM 99 C CB . THR 15 15 ? A 5.926 5.229 5.606 1 1 A THR 0.710 1
ATOM 100 O OG1 . THR 15 15 ? A 5.944 3.857 5.960 1 1 A THR 0.710 1
ATOM 101 C CG2 . THR 15 15 ? A 7.201 5.847 6.180 1 1 A THR 0.710 1
ATOM 102 N N . THR 16 16 ? A 2.276 5.301 5.841 1 1 A THR 0.690 1
ATOM 103 C CA . THR 16 16 ? A 0.999 5.169 5.120 1 1 A THR 0.690 1
ATOM 104 C C . THR 16 16 ? A 0.624 6.423 4.357 1 1 A THR 0.690 1
ATOM 105 O O . THR 16 16 ? A -0.050 6.370 3.340 1 1 A THR 0.690 1
ATOM 106 C CB . THR 16 16 ? A -0.227 4.805 5.947 1 1 A THR 0.690 1
ATOM 107 O OG1 . THR 16 16 ? A -0.399 5.706 7.026 1 1 A THR 0.690 1
ATOM 108 C CG2 . THR 16 16 ? A -0.104 3.412 6.556 1 1 A THR 0.690 1
ATOM 109 N N . VAL 17 17 ? A 1.132 7.587 4.818 1 1 A VAL 0.620 1
ATOM 110 C CA . VAL 17 17 ? A 1.049 8.864 4.128 1 1 A VAL 0.620 1
ATOM 111 C C . VAL 17 17 ? A 1.618 8.861 2.707 1 1 A VAL 0.620 1
ATOM 112 O O . VAL 17 17 ? A 1.132 9.574 1.840 1 1 A VAL 0.620 1
ATOM 113 C CB . VAL 17 17 ? A 1.637 10.021 4.945 1 1 A VAL 0.620 1
ATOM 114 C CG1 . VAL 17 17 ? A 0.912 10.113 6.303 1 1 A VAL 0.620 1
ATOM 115 C CG2 . VAL 17 17 ? A 3.165 9.922 5.126 1 1 A VAL 0.620 1
ATOM 116 N N . VAL 18 18 ? A 2.655 8.032 2.434 1 1 A VAL 0.690 1
ATOM 117 C CA . VAL 18 18 ? A 3.270 7.892 1.121 1 1 A VAL 0.690 1
ATOM 118 C C . VAL 18 18 ? A 2.917 6.546 0.501 1 1 A VAL 0.690 1
ATOM 119 O O . VAL 18 18 ? A 3.531 6.121 -0.469 1 1 A VAL 0.690 1
ATOM 120 C CB . VAL 18 18 ? A 4.792 8.117 1.113 1 1 A VAL 0.690 1
ATOM 121 C CG1 . VAL 18 18 ? A 5.101 9.591 1.443 1 1 A VAL 0.690 1
ATOM 122 C CG2 . VAL 18 18 ? A 5.542 7.155 2.054 1 1 A VAL 0.690 1
ATOM 123 N N . GLY 19 19 ? A 1.878 5.862 1.037 1 1 A GLY 0.760 1
ATOM 124 C CA . GLY 19 19 ? A 1.336 4.627 0.485 1 1 A GLY 0.760 1
ATOM 125 C C . GLY 19 19 ? A 1.783 3.360 1.146 1 1 A GLY 0.760 1
ATOM 126 O O . GLY 19 19 ? A 1.196 2.317 0.941 1 1 A GLY 0.760 1
ATOM 127 N N . CYS 20 20 ? A 2.784 3.413 2.037 1 1 A CYS 0.780 1
ATOM 128 C CA . CYS 20 20 ? A 3.358 2.212 2.600 1 1 A CYS 0.780 1
ATOM 129 C C . CYS 20 20 ? A 2.411 1.532 3.576 1 1 A CYS 0.780 1
ATOM 130 O O . CYS 20 20 ? A 1.460 2.119 4.083 1 1 A CYS 0.780 1
ATOM 131 C CB . CYS 20 20 ? A 4.699 2.503 3.296 1 1 A CYS 0.780 1
ATOM 132 S SG . CYS 20 20 ? A 5.869 3.350 2.193 1 1 A CYS 0.780 1
ATOM 133 N N . SER 21 21 ? A 2.612 0.247 3.885 1 1 A SER 0.800 1
ATOM 134 C CA . SER 21 21 ? A 1.751 -0.438 4.816 1 1 A SER 0.800 1
ATOM 135 C C . SER 21 21 ? A 2.487 -1.504 5.576 1 1 A SER 0.800 1
ATOM 136 O O . SER 21 21 ? A 3.550 -1.974 5.171 1 1 A SER 0.800 1
ATOM 137 C CB . SER 21 21 ? A 0.426 -0.964 4.185 1 1 A SER 0.800 1
ATOM 138 O OG . SER 21 21 ? A 0.568 -1.972 3.178 1 1 A SER 0.800 1
ATOM 139 N N . CYS 22 22 ? A 1.971 -1.875 6.768 1 1 A CYS 0.790 1
ATOM 140 C CA . CYS 22 22 ? A 2.625 -2.848 7.627 1 1 A CYS 0.790 1
ATOM 141 C C . CYS 22 22 ? A 2.495 -4.264 7.093 1 1 A CYS 0.790 1
ATOM 142 O O . CYS 22 22 ? A 1.392 -4.797 6.990 1 1 A CYS 0.790 1
ATOM 143 C CB . CYS 22 22 ? A 2.054 -2.816 9.070 1 1 A CYS 0.790 1
ATOM 144 S SG . CYS 22 22 ? A 3.043 -3.751 10.273 1 1 A CYS 0.790 1
ATOM 145 N N . LYS 23 23 ? A 3.619 -4.910 6.738 1 1 A LYS 0.740 1
ATOM 146 C CA . LYS 23 23 ? A 3.646 -6.290 6.311 1 1 A LYS 0.740 1
ATOM 147 C C . LYS 23 23 ? A 4.797 -6.934 7.033 1 1 A LYS 0.740 1
ATOM 148 O O . LYS 23 23 ? A 5.914 -6.432 6.981 1 1 A LYS 0.740 1
ATOM 149 C CB . LYS 23 23 ? A 3.894 -6.444 4.787 1 1 A LYS 0.740 1
ATOM 150 C CG . LYS 23 23 ? A 2.930 -5.650 3.901 1 1 A LYS 0.740 1
ATOM 151 C CD . LYS 23 23 ? A 1.490 -6.170 3.999 1 1 A LYS 0.740 1
ATOM 152 C CE . LYS 23 23 ? A 0.447 -5.150 3.572 1 1 A LYS 0.740 1
ATOM 153 N NZ . LYS 23 23 ? A 0.743 -4.736 2.192 1 1 A LYS 0.740 1
ATOM 154 N N . ASN 24 24 ? A 4.579 -8.043 7.764 1 1 A ASN 0.710 1
ATOM 155 C CA . ASN 24 24 ? A 5.646 -8.782 8.424 1 1 A ASN 0.710 1
ATOM 156 C C . ASN 24 24 ? A 6.580 -7.943 9.297 1 1 A ASN 0.710 1
ATOM 157 O O . ASN 24 24 ? A 7.787 -8.137 9.301 1 1 A ASN 0.710 1
ATOM 158 C CB . ASN 24 24 ? A 6.467 -9.627 7.422 1 1 A ASN 0.710 1
ATOM 159 C CG . ASN 24 24 ? A 5.536 -10.638 6.769 1 1 A ASN 0.710 1
ATOM 160 O OD1 . ASN 24 24 ? A 4.687 -11.221 7.426 1 1 A ASN 0.710 1
ATOM 161 N ND2 . ASN 24 24 ? A 5.694 -10.852 5.440 1 1 A ASN 0.710 1
ATOM 162 N N . LYS 25 25 ? A 5.983 -7.013 10.082 1 1 A LYS 0.730 1
ATOM 163 C CA . LYS 25 25 ? A 6.647 -6.146 11.042 1 1 A LYS 0.730 1
ATOM 164 C C . LYS 25 25 ? A 7.334 -4.917 10.459 1 1 A LYS 0.730 1
ATOM 165 O O . LYS 25 25 ? A 7.871 -4.098 11.204 1 1 A LYS 0.730 1
ATOM 166 C CB . LYS 25 25 ? A 7.670 -6.890 11.938 1 1 A LYS 0.730 1
ATOM 167 C CG . LYS 25 25 ? A 7.169 -8.232 12.488 1 1 A LYS 0.730 1
ATOM 168 C CD . LYS 25 25 ? A 8.066 -8.807 13.589 1 1 A LYS 0.730 1
ATOM 169 C CE . LYS 25 25 ? A 9.499 -9.093 13.135 1 1 A LYS 0.730 1
ATOM 170 N NZ . LYS 25 25 ? A 10.261 -9.678 14.260 1 1 A LYS 0.730 1
ATOM 171 N N . VAL 26 26 ? A 7.308 -4.734 9.127 1 1 A VAL 0.800 1
ATOM 172 C CA . VAL 26 26 ? A 8.031 -3.672 8.448 1 1 A VAL 0.800 1
ATOM 173 C C . VAL 26 26 ? A 7.055 -2.919 7.550 1 1 A VAL 0.800 1
ATOM 174 O O . VAL 26 26 ? A 6.063 -3.463 7.065 1 1 A VAL 0.800 1
ATOM 175 C CB . VAL 26 26 ? A 9.226 -4.240 7.679 1 1 A VAL 0.800 1
ATOM 176 C CG1 . VAL 26 26 ? A 10.015 -3.164 6.909 1 1 A VAL 0.800 1
ATOM 177 C CG2 . VAL 26 26 ? A 10.162 -4.992 8.651 1 1 A VAL 0.800 1
ATOM 178 N N . CYS 27 27 ? A 7.270 -1.608 7.333 1 1 A CYS 0.800 1
ATOM 179 C CA . CYS 27 27 ? A 6.464 -0.814 6.428 1 1 A CYS 0.800 1
ATOM 180 C C . CYS 27 27 ? A 6.983 -0.903 4.996 1 1 A CYS 0.800 1
ATOM 181 O O . CYS 27 27 ? A 8.147 -0.597 4.728 1 1 A CYS 0.800 1
ATOM 182 C CB . CYS 27 27 ? A 6.445 0.655 6.895 1 1 A CYS 0.800 1
ATOM 183 S SG . CYS 27 27 ? A 5.869 0.795 8.607 1 1 A CYS 0.800 1
ATOM 184 N N . TYR 28 28 ? A 6.129 -1.333 4.043 1 1 A TYR 0.440 1
ATOM 185 C CA . TYR 28 28 ? A 6.461 -1.567 2.647 1 1 A TYR 0.440 1
ATOM 186 C C . TYR 28 28 ? A 5.457 -0.907 1.710 1 1 A TYR 0.440 1
ATOM 187 O O . TYR 28 28 ? A 4.284 -0.803 2.050 1 1 A TYR 0.440 1
ATOM 188 C CB . TYR 28 28 ? A 6.322 -3.072 2.292 1 1 A TYR 0.440 1
ATOM 189 C CG . TYR 28 28 ? A 7.353 -3.961 2.909 1 1 A TYR 0.440 1
ATOM 190 C CD1 . TYR 28 28 ? A 7.121 -4.589 4.137 1 1 A TYR 0.440 1
ATOM 191 C CD2 . TYR 28 28 ? A 8.511 -4.293 2.197 1 1 A TYR 0.440 1
ATOM 192 C CE1 . TYR 28 28 ? A 7.998 -5.567 4.612 1 1 A TYR 0.440 1
ATOM 193 C CE2 . TYR 28 28 ? A 9.432 -5.221 2.707 1 1 A TYR 0.440 1
ATOM 194 C CZ . TYR 28 28 ? A 9.165 -5.870 3.918 1 1 A TYR 0.440 1
ATOM 195 O OH . TYR 28 28 ? A 10.023 -6.852 4.451 1 1 A TYR 0.440 1
ATOM 196 N N . ASP 29 29 ? A 5.884 -0.533 0.501 1 1 A ASP 0.410 1
ATOM 197 C CA . ASP 29 29 ? A 5.062 -0.318 -0.668 1 1 A ASP 0.410 1
ATOM 198 C C . ASP 29 29 ? A 5.679 -1.320 -1.715 1 1 A ASP 0.410 1
ATOM 199 O O . ASP 29 29 ? A 6.711 -1.963 -1.371 1 1 A ASP 0.410 1
ATOM 200 C CB . ASP 29 29 ? A 5.061 1.202 -1.008 1 1 A ASP 0.410 1
ATOM 201 C CG . ASP 29 29 ? A 4.001 1.596 -2.033 1 1 A ASP 0.410 1
ATOM 202 O OD1 . ASP 29 29 ? A 4.326 2.391 -2.957 1 1 A ASP 0.410 1
ATOM 203 O OD2 . ASP 29 29 ? A 2.827 1.180 -1.848 1 1 A ASP 0.410 1
ATOM 204 O OXT . ASP 29 29 ? A 5.131 -1.537 -2.818 1 1 A ASP 0.410 1
#
#
loop_
_atom_type.symbol
C
N
O
S
#
#
loop_
_ma_qa_metric.id
_ma_qa_metric.name
_ma_qa_metric.description
_ma_qa_metric.type
_ma_qa_metric.mode
_ma_qa_metric.type_other_details
_ma_qa_metric.software_group_id
1 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].'
'pLDDT all-atom in [0,1]' local . 5
2 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].'
'pLDDT all-atom in [0,1]' global . 5
3 GMQE
'Global Model Quality Estimate of the model accuracy, calculated by SWISS-MODEL.'
'normalized score' global . 6
#
#
loop_
_ma_qa_metric_global.ordinal_id
_ma_qa_metric_global.model_id
_ma_qa_metric_global.metric_id
_ma_qa_metric_global.metric_value
1 1 2 0.684
2 1 3 0.697
#
#
loop_
_ma_qa_metric_local.ordinal_id
_ma_qa_metric_local.model_id
_ma_qa_metric_local.label_asym_id
_ma_qa_metric_local.label_seq_id
_ma_qa_metric_local.label_comp_id
_ma_qa_metric_local.metric_id
_ma_qa_metric_local.metric_value
1 1 A 2 GLU 1 0.420
2 1 A 3 PRO 1 0.440
3 1 A 4 CYS 1 0.780
4 1 A 5 GLY 1 0.800
5 1 A 6 GLU 1 0.770
6 1 A 7 SER 1 0.790
7 1 A 8 CYS 1 0.760
8 1 A 9 VAL 1 0.610
9 1 A 10 PHE 1 0.480
10 1 A 11 ILE 1 0.570
11 1 A 12 PRO 1 0.760
12 1 A 13 CYS 1 0.770
13 1 A 14 ILE 1 0.740
14 1 A 15 THR 1 0.710
15 1 A 16 THR 1 0.690
16 1 A 17 VAL 1 0.620
17 1 A 18 VAL 1 0.690
18 1 A 19 GLY 1 0.760
19 1 A 20 CYS 1 0.780
20 1 A 21 SER 1 0.800
21 1 A 22 CYS 1 0.790
22 1 A 23 LYS 1 0.740
23 1 A 24 ASN 1 0.710
24 1 A 25 LYS 1 0.730
25 1 A 26 VAL 1 0.800
26 1 A 27 CYS 1 0.800
27 1 A 28 TYR 1 0.440
28 1 A 29 ASP 1 0.410
#
#
loop_
_pdbx_data_usage.id
_pdbx_data_usage.type
_pdbx_data_usage.details
_pdbx_data_usage.url
1 license
;This SWISS-MODEL protein model is copyright.
It is produced by the SWISS-MODEL server, developed by the Computational
Structural Biology Group at the SIB Swiss Institute of Bioinformatics at the
Biozentrum, University of Basel (https://swissmodel.expasy.org). This
model is licensed under the CC BY-SA 4.0 Creative Commons
Attribution-ShareAlike 4.0 International License
(https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
can copy and redistribute the model in any medium or format,
transform and build upon the model for any purpose, even
commercially, under the following terms:
Attribution - You must give appropriate credit, provide a link to
the license, and indicate if changes were made. You may do so in any
reasonable manner, but not in any way that suggests the licensor
endorses you or your use. When you publish, patent or distribute
results that were fully or partially based on the model, please cite
the corresponding papers mentioned under JRNL.
ShareAlike - If you remix, transform, or build upon the material,
you must distribute your contributions under the same license as the
original.
No additional restrictions - you may not apply legal terms or
technological measures that legally restrict others from doing
anything the license permits.
Find a human-readable summary of (and not a substitute for) the
CC BY-SA 4.0 license at this link:
https://creativecommons.org/licenses/by-sa/4.0/
;
https://creativecommons.org/licenses/by-sa/4.0/legalcode
2 disclaimer
;The SWISS-MODEL SERVER produces theoretical models for
proteins. The results of any theoretical modelling procedure is
NON-EXPERIMENTAL and MUST be considered with care. These models may
contain significant errors. This is especially true for automated
modeling since there is no human intervention during model
building. Please read the header section and the logfile carefully
to know what templates and alignments were used during the model
building process. All information by the SWISS-MODEL SERVER is
provided "AS-IS", without any warranty, expressed or implied.
;
https://swissmodel.expasy.org/docs/terms_of_use#disclaimer
#