data_SMR-5d92c99c163d157583faf18f066de400_1 _entry.id SMR-5d92c99c163d157583faf18f066de400_1 _struct.entry_id SMR-5d92c99c163d157583faf18f066de400_1 _struct.pdbx_model_details ;This model was generated unsupervised by the SWISS-MODEL homology-modelling pipeline for the SWISS-MODEL Repository, a database of annotated 3D protein structure models. The modelled monomer covers following UniProtKB entries: - F5H7E5/ F5H7E5_HUMAN, Phospholipase A and acyltransferase 3 Estimated model accuracy of this model is 0.374, calculated by SWISS-MODEL as Global Model Quality Estimate (GMQE). ; _struct.pdbx_structure_determination_methodology computational _struct.title 'Model for UniProtKB entries F5H7E5' _audit_conform.dict_location https://raw.githubusercontent.com/ihmwg/ModelCIF/80e1e22/dist/mmcif_ma.dic _audit_conform.dict_name mmcif_ma.dic _audit_conform.dict_version 1.4.7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'The SWISS-MODEL Repository - new features and functionality' 'Nucleic Acids Res.' 45 D313 D319 2017 27899672 10.1093/nar/gkw1132 2 'SWISS-MODEL: homology modelling of protein structures and complexes' 'Nucleic Acids Res.' 46 W296 W303 2018 29788355 10.1093/nar/gky427 3 'ProMod3 - A versatile homology modelling toolbox' 'PLoS Comput. Biol.' 17(1) 1 18 2021 33507980 10.1371/journal.pcbi.1008667 4 'QMEANDisCo - distance constraints applied on model quality estimation' Bioinformatics 36 1765 1771 2020 31697312 10.1093/bioinformatics/btz828 5 'OpenStructure: an integrated software framework for computational structural biology' 'Acta Crystallogr., Sect. D: Biol. Crystallogr.' 69 701 709 2013 23633579 10.1107/S0907444913007051 6 'BLAST+: architecture and applications' 'BMC Bioinf.' 10 421 . 2009 20003500 10.1186/1471-2105-10-421 7 'HH-suite3 for fast remote homology detection and deep protein annotation' 'BMC Bioinf.' 20 473 . 2019 31521110 10.1186/s12859-019-3019-7 # # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Bienert, S.' 1 primary 'Waterhouse, A.' 2 primary 'de Beer, T.A.P.' 3 primary 'Tauriello, G.' 4 primary 'Studer, G.' 5 primary 'Bordoli, L.' 6 primary 'Schwede, T.' 7 2 'Waterhouse, A.' 8 2 'Bertoni, M.' 9 2 'Bienert, S.' 10 2 'Studer, G.' 11 2 'Tauriello, G.' 12 2 'Gumienny, R.' 13 2 'Heer, F.T.' 14 2 'de Beer, T.A.P.' 15 2 'Rempfer, C.' 16 2 'Bordoli, L.' 17 2 'Lepore, R.' 18 2 'Schwede, T.' 19 3 'Studer, G.' 20 3 'Tauriello, G.' 21 3 'Bienert, S.' 22 3 'Biasini, M.' 23 3 'Johner, N.' 24 3 'Schwede, T.' 25 4 'Studer, G.' 26 4 'Rempfer, C.' 27 4 'Waterhouse, A.M.' 28 4 'Gumienny, R.' 29 4 'Haas, J.' 30 4 'Schwede, T.' 31 5 'Biasini, M.' 32 5 'Schmidt, T.' 33 5 'Bienert, S.' 34 5 'Mariani, V.' 35 5 'Studer, G.' 36 5 'Haas, J.' 37 5 'Johner, N.' 38 5 'Schenk, A.D.' 39 5 'Philippsen, A.' 40 5 'Schwede, T.' 41 6 'Camacho, C.' 42 6 'Coulouris, G.' 43 6 'Avagyan, V.' 44 6 'Ma, N.' 45 6 'Papadopoulos, J.' 46 6 'Bealer, K.' 47 6 'Madden, T.L.' 48 7 'Steinegger, M.' 49 7 'Meier, M.' 50 7 'Mirdita, M.' 51 7 'Vohringer, H.' 52 7 'Haunsberger, S.J.' 53 7 'Soding, J.' 54 # # loop_ _software.pdbx_ordinal _software.name _software.classification _software.description _software.version _software.type _software.location _software.citation_id 1 SWISS-MODEL 'model building' 'Homology modelling web service' 2025-06.1 package https://swissmodel.expasy.org 2 2 ProMod3 'model building' 'Modular homology modelling engine' 3.5.0 library https://git.scicore.unibas.ch/schwede/ProMod3 3 3 QMEAN 'model building' 'QMEAN - Qualitative Model Energy ANalysis' 4.4.0 library https://git.scicore.unibas.ch/schwede/QMEAN 4 4 OpenStructure 'data processing' 'Open-Source Computational Structural Biology Framework' 2.10.0 package https://openstructure.org/ 5 5 BLAST 'data collection' . 2.14.1 package https://blast.ncbi.nlm.nih.gov 6 6 HH-suite 'data collection' 'HH-suite3 for sensitive sequence searching' 3.2.0 package https://github.com/soedinglab/hh-suite 7 # # loop_ _ma_software_group.ordinal_id _ma_software_group.group_id _ma_software_group.software_id _ma_software_group.parameter_group_id 1 1 5 . 2 2 1 . 3 2 4 . 4 2 5 . 5 2 6 . 6 3 1 . 7 3 4 . 8 4 1 . 9 4 2 . 10 4 4 . 11 5 3 . 12 6 1 . 13 6 3 . 14 6 4 . # # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bienert, S.' 1 'Waterhouse, A.' 2 'de Beer, T.A.P.' 3 'Tauriello, G.' 4 'Studer, G.' 5 'Bordoli, L.' 6 'Schwede, T.' 7 # # loop_ _chem_comp.id _chem_comp.type _chem_comp.name _chem_comp.formula _chem_comp.formula_weight _chem_comp.ma_provenance ALA 'L-peptide linking' ALANINE 'C3 H7 N O2' 89.094 'CCD Core' ARG 'L-peptide linking' ARGININE 'C6 H15 N4 O2 1' 175.212 'CCD Core' ASN 'L-peptide linking' ASPARAGINE 'C4 H8 N2 O3' 132.119 'CCD Core' ASP 'L-peptide linking' 'ASPARTIC ACID' 'C4 H7 N O4' 133.103 'CCD Core' CYS 'L-peptide linking' CYSTEINE 'C3 H7 N O2 S' 121.154 'CCD Core' GLN 'L-peptide linking' GLUTAMINE 'C5 H10 N2 O3' 146.146 'CCD Core' GLU 'L-peptide linking' 'GLUTAMIC ACID' 'C5 H9 N O4' 147.130 'CCD Core' GLY 'peptide linking' GLYCINE 'C2 H5 N O2' 75.067 'CCD Core' HIS 'L-peptide linking' HISTIDINE 'C6 H10 N3 O2 1' 156.165 'CCD Core' ILE 'L-peptide linking' ISOLEUCINE 'C6 H13 N O2' 131.175 'CCD Core' LEU 'L-peptide linking' LEUCINE 'C6 H13 N O2' 131.175 'CCD Core' LYS 'L-peptide linking' LYSINE 'C6 H15 N2 O2 1' 147.198 'CCD Core' MET 'L-peptide linking' METHIONINE 'C5 H11 N O2 S' 149.208 'CCD Core' PHE 'L-peptide linking' PHENYLALANINE 'C9 H11 N O2' 165.192 'CCD Core' PRO 'L-peptide linking' PROLINE 'C5 H9 N O2' 115.132 'CCD Core' SER 'L-peptide linking' SERINE 'C3 H7 N O3' 105.093 'CCD Core' THR 'L-peptide linking' THREONINE 'C4 H9 N O3' 119.120 'CCD Core' TRP 'L-peptide linking' TRYPTOPHAN 'C11 H12 N2 O2' 204.229 'CCD Core' TYR 'L-peptide linking' TYROSINE 'C9 H11 N O3' 181.191 'CCD Core' VAL 'L-peptide linking' VALINE 'C5 H11 N O2' 117.148 'CCD Core' # # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.details 1 polymer man . 3472.885 1 . # # loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.details 1 1 UNP F5H7E5_HUMAN F5H7E5 1 MSALTDKAIVKKELLYDVAGSDKYQVN 'Phospholipase A and acyltransferase 3' # # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.seq_align_beg _struct_ref_seq.seq_align_end _struct_ref_seq.db_align_beg _struct_ref_seq.db_align_end 1 1 1 27 1 27 # # loop_ _ma_target_ref_db_details.target_entity_id _ma_target_ref_db_details.db_name _ma_target_ref_db_details.db_name_other_details _ma_target_ref_db_details.db_code _ma_target_ref_db_details.db_accession _ma_target_ref_db_details.seq_db_isoform _ma_target_ref_db_details.seq_db_align_begin _ma_target_ref_db_details.seq_db_align_end _ma_target_ref_db_details.ncbi_taxonomy_id _ma_target_ref_db_details.organism_scientific _ma_target_ref_db_details.seq_db_sequence_version_date _ma_target_ref_db_details.seq_db_sequence_checksum _ma_target_ref_db_details.is_primary 1 UNP . F5H7E5_HUMAN F5H7E5 . 1 27 9606 'Homo sapiens (Human)' 2011-06-28 1ACEF8ED60735148 . # # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_strand_id _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can 1 polypeptide(L) no no A MSALTDKAIVKKELLYDVAGSDKYQVN MSALTDKAIVKKELLYDVAGSDKYQVN # # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET . 1 2 SER . 1 3 ALA . 1 4 LEU . 1 5 THR . 1 6 ASP . 1 7 LYS . 1 8 ALA . 1 9 ILE . 1 10 VAL . 1 11 LYS . 1 12 LYS . 1 13 GLU . 1 14 LEU . 1 15 LEU . 1 16 TYR . 1 17 ASP . 1 18 VAL . 1 19 ALA . 1 20 GLY . 1 21 SER . 1 22 ASP . 1 23 LYS . 1 24 TYR . 1 25 GLN . 1 26 VAL . 1 27 ASN . # # loop_ _struct_asym.id _struct_asym.entity_id _struct_asym.details A 1 . # # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 MET 1 ? ? ? A . A 1 2 SER 2 ? ? ? A . A 1 3 ALA 3 ? ? ? A . A 1 4 LEU 4 ? ? ? A . A 1 5 THR 5 ? ? ? A . A 1 6 ASP 6 ? ? ? A . A 1 7 LYS 7 7 LYS LYS A . A 1 8 ALA 8 8 ALA ALA A . A 1 9 ILE 9 9 ILE ILE A . A 1 10 VAL 10 10 VAL VAL A . A 1 11 LYS 11 11 LYS LYS A . A 1 12 LYS 12 12 LYS LYS A . A 1 13 GLU 13 13 GLU GLU A . A 1 14 LEU 14 14 LEU LEU A . A 1 15 LEU 15 15 LEU LEU A . A 1 16 TYR 16 16 TYR TYR A . A 1 17 ASP 17 17 ASP ASP A . A 1 18 VAL 18 18 VAL VAL A . A 1 19 ALA 19 19 ALA ALA A . A 1 20 GLY 20 20 GLY GLY A . A 1 21 SER 21 21 SER SER A . A 1 22 ASP 22 22 ASP ASP A . A 1 23 LYS 23 23 LYS LYS A . A 1 24 TYR 24 24 TYR TYR A . A 1 25 GLN 25 25 GLN GLN A . A 1 26 VAL 26 26 VAL VAL A . A 1 27 ASN 27 27 ASN ASN A . # # loop_ _ma_data.id _ma_data.name _ma_data.content_type _ma_data.content_type_other_details 1 'Phospholipase A and acyltransferase 3 {PDB ID=7zom, label_asym_id=A, auth_asym_id=A, SMTL ID=7zom.1.A}' 'template structure' . 2 . target . 3 'Target-template alignment by BLAST to 7zom, label_asym_id=A' 'target-template alignment' . 4 'model 1' 'model coordinates' . 5 SMTL 'reference database' . 6 PDB 'reference database' . 7 'Template search output' other 'Results of the sequence search' # # loop_ _ma_data_group.ordinal_id _ma_data_group.group_id _ma_data_group.data_id 1 1 2 2 1 5 3 1 6 4 2 7 5 3 2 6 3 1 7 3 3 8 4 1 9 4 3 10 5 4 # # loop_ _ma_data_ref_db.data_id _ma_data_ref_db.name _ma_data_ref_db.location_url _ma_data_ref_db.version _ma_data_ref_db.release_date 5 SMTL https://swissmodel.expasy.org/templates/ . 2025-06-12 6 PDB https://www.wwpdb.org . 2025-06-06 # # loop_ _ma_target_entity.entity_id _ma_target_entity.data_id _ma_target_entity.origin 1 2 'reference database' # # loop_ _ma_target_entity_instance.asym_id _ma_target_entity_instance.entity_id _ma_target_entity_instance.details A 1 . # # loop_ _ma_template_trans_matrix.id _ma_template_trans_matrix.rot_matrix[1][1] _ma_template_trans_matrix.rot_matrix[2][1] _ma_template_trans_matrix.rot_matrix[3][1] _ma_template_trans_matrix.rot_matrix[1][2] _ma_template_trans_matrix.rot_matrix[2][2] _ma_template_trans_matrix.rot_matrix[3][2] _ma_template_trans_matrix.rot_matrix[1][3] _ma_template_trans_matrix.rot_matrix[2][3] _ma_template_trans_matrix.rot_matrix[3][3] _ma_template_trans_matrix.tr_vector[1] _ma_template_trans_matrix.tr_vector[2] _ma_template_trans_matrix.tr_vector[3] 1 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0 0 0 # # loop_ _ma_template_details.ordinal_id _ma_template_details.template_id _ma_template_details.template_origin _ma_template_details.template_entity_type _ma_template_details.template_trans_matrix_id _ma_template_details.template_data_id _ma_template_details.target_asym_id _ma_template_details.template_label_asym_id _ma_template_details.template_label_entity_id _ma_template_details.template_model_num _ma_template_details.template_auth_asym_id 1 1 'reference database' polymer 1 1 A A 1 1 A # # loop_ _ma_template_poly.template_id _ma_template_poly.seq_one_letter_code _ma_template_poly.seq_one_letter_code_can 1 ;MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAG SDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD ; ;MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAG SDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD ; # # loop_ _ma_template_poly_segment.id _ma_template_poly_segment.template_id _ma_template_poly_segment.residue_number_begin _ma_template_poly_segment.residue_number_end 1 1 51 77 # # loop_ _ma_template_ref_db_details.template_id _ma_template_ref_db_details.db_name _ma_template_ref_db_details.db_name_other_details _ma_template_ref_db_details.db_accession_code _ma_template_ref_db_details.db_version_date 1 PDB . 7zom 2024-06-19 # # loop_ _ma_target_template_poly_mapping.id _ma_target_template_poly_mapping.template_segment_id _ma_target_template_poly_mapping.target_asym_id _ma_target_template_poly_mapping.target_seq_id_begin _ma_target_template_poly_mapping.target_seq_id_end 1 1 A 1 27 # # loop_ _ma_alignment_info.alignment_id _ma_alignment_info.data_id _ma_alignment_info.software_group_id _ma_alignment_info.alignment_length _ma_alignment_info.alignment_type _ma_alignment_info.alignment_mode 1 3 1 27 'target-template pairwise alignment' local # # loop_ _ma_alignment_details.ordinal_id _ma_alignment_details.alignment_id _ma_alignment_details.template_segment_id _ma_alignment_details.target_asym_id _ma_alignment_details.score_type _ma_alignment_details.score_type_other_details _ma_alignment_details.score_value _ma_alignment_details.percent_sequence_identity _ma_alignment_details.sequence_identity_denominator _ma_alignment_details.sequence_identity_denominator_other_details 1 1 1 A 'BLAST e-value' . 1.2e-11 100.000 'Number of aligned residue pairs (not including the gaps)' . # # loop_ _ma_alignment.ordinal_id _ma_alignment.alignment_id _ma_alignment.target_template_flag _ma_alignment.sequence 1 1 1 MSALTDKAIVKKELLYDVAGSDKYQVN 2 1 2 MSALTDKAIVKKELLYDVAGSDKYQVN # # loop_ _ma_protocol_step.ordinal_id _ma_protocol_step.protocol_id _ma_protocol_step.step_id _ma_protocol_step.method_type _ma_protocol_step.step_name _ma_protocol_step.details _ma_protocol_step.software_group_id _ma_protocol_step.input_data_group_id _ma_protocol_step.output_data_group_id 1 1 1 'template search' 'template search' 'SWISS-MODEL template search in PDB' 2 1 2 2 1 2 'template selection' 'template selection' 'Automatic template selection by SWISS-MODEL' 3 2 4 3 1 3 modeling 'homology modeling' 'SWISS-MODEL auto-model mode using ProMod3 on 7zom.1' 4 3 5 # # loop_ _ma_model_list.ordinal_id _ma_model_list.model_name _ma_model_list.data_id _ma_model_list.model_type _ma_model_list.model_type_other_details 1 'model 1' 4 'Homology model' . # # loop_ _ma_model_group.id _ma_model_group.name _ma_model_group.details 1 . . # # loop_ _ma_model_group_link.group_id _ma_model_group_link.model_id 1 1 # # loop_ _atom_site.group_PDB _atom_site.id _atom_site.type_symbol _atom_site.label_atom_id _atom_site.label_alt_id _atom_site.label_comp_id _atom_site.label_seq_id _atom_site.auth_seq_id _atom_site.pdbx_PDB_ins_code _atom_site.label_asym_id _atom_site.Cartn_x _atom_site.Cartn_y _atom_site.Cartn_z _atom_site.occupancy _atom_site.label_entity_id _atom_site.auth_asym_id _atom_site.auth_comp_id _atom_site.B_iso_or_equiv _atom_site.pdbx_PDB_model_num ATOM 1 N N . LYS 7 7 ? A 22.060 -0.820 4.008 1 1 A LYS 0.640 1 ATOM 2 C CA . LYS 7 7 ? A 23.477 -0.775 4.531 1 1 A LYS 0.640 1 ATOM 3 C C . LYS 7 7 ? A 24.064 -2.177 4.595 1 1 A LYS 0.640 1 ATOM 4 O O . LYS 7 7 ? A 23.300 -3.134 4.501 1 1 A LYS 0.640 1 ATOM 5 C CB . LYS 7 7 ? A 23.508 -0.089 5.932 1 1 A LYS 0.640 1 ATOM 6 C CG . LYS 7 7 ? A 24.861 0.566 6.290 1 1 A LYS 0.640 1 ATOM 7 C CD . LYS 7 7 ? A 24.766 1.543 7.481 1 1 A LYS 0.640 1 ATOM 8 C CE . LYS 7 7 ? A 25.934 2.541 7.529 1 1 A LYS 0.640 1 ATOM 9 N NZ . LYS 7 7 ? A 25.739 3.529 8.616 1 1 A LYS 0.640 1 ATOM 10 N N . ALA 8 8 ? A 25.390 -2.353 4.751 1 1 A ALA 0.660 1 ATOM 11 C CA . ALA 8 8 ? A 25.997 -3.654 4.901 1 1 A ALA 0.660 1 ATOM 12 C C . ALA 8 8 ? A 26.916 -3.528 6.098 1 1 A ALA 0.660 1 ATOM 13 O O . ALA 8 8 ? A 27.236 -2.410 6.511 1 1 A ALA 0.660 1 ATOM 14 C CB . ALA 8 8 ? A 26.783 -4.048 3.630 1 1 A ALA 0.660 1 ATOM 15 N N . ILE 9 9 ? A 27.317 -4.658 6.703 1 1 A ILE 0.460 1 ATOM 16 C CA . ILE 9 9 ? A 28.121 -4.699 7.906 1 1 A ILE 0.460 1 ATOM 17 C C . ILE 9 9 ? A 29.108 -5.837 7.751 1 1 A ILE 0.460 1 ATOM 18 O O . ILE 9 9 ? A 28.779 -6.883 7.190 1 1 A ILE 0.460 1 ATOM 19 C CB . ILE 9 9 ? A 27.274 -4.882 9.177 1 1 A ILE 0.460 1 ATOM 20 C CG1 . ILE 9 9 ? A 28.130 -4.905 10.466 1 1 A ILE 0.460 1 ATOM 21 C CG2 . ILE 9 9 ? A 26.378 -6.138 9.078 1 1 A ILE 0.460 1 ATOM 22 C CD1 . ILE 9 9 ? A 27.331 -4.602 11.738 1 1 A ILE 0.460 1 ATOM 23 N N . VAL 10 10 ? A 30.365 -5.653 8.208 1 1 A VAL 0.590 1 ATOM 24 C CA . VAL 10 10 ? A 31.370 -6.703 8.264 1 1 A VAL 0.590 1 ATOM 25 C C . VAL 10 10 ? A 30.993 -7.691 9.356 1 1 A VAL 0.590 1 ATOM 26 O O . VAL 10 10 ? A 30.825 -7.312 10.516 1 1 A VAL 0.590 1 ATOM 27 C CB . VAL 10 10 ? A 32.771 -6.150 8.523 1 1 A VAL 0.590 1 ATOM 28 C CG1 . VAL 10 10 ? A 33.817 -7.284 8.515 1 1 A VAL 0.590 1 ATOM 29 C CG2 . VAL 10 10 ? A 33.125 -5.104 7.447 1 1 A VAL 0.590 1 ATOM 30 N N . LYS 11 11 ? A 30.819 -8.979 9.013 1 1 A LYS 0.590 1 ATOM 31 C CA . LYS 11 11 ? A 30.413 -9.990 9.960 1 1 A LYS 0.590 1 ATOM 32 C C . LYS 11 11 ? A 31.420 -11.103 10.000 1 1 A LYS 0.590 1 ATOM 33 O O . LYS 11 11 ? A 32.104 -11.402 9.019 1 1 A LYS 0.590 1 ATOM 34 C CB . LYS 11 11 ? A 29.053 -10.630 9.615 1 1 A LYS 0.590 1 ATOM 35 C CG . LYS 11 11 ? A 27.898 -9.628 9.597 1 1 A LYS 0.590 1 ATOM 36 C CD . LYS 11 11 ? A 26.553 -10.357 9.505 1 1 A LYS 0.590 1 ATOM 37 C CE . LYS 11 11 ? A 25.358 -9.439 9.293 1 1 A LYS 0.590 1 ATOM 38 N NZ . LYS 11 11 ? A 24.157 -10.273 9.096 1 1 A LYS 0.590 1 ATOM 39 N N . LYS 12 12 ? A 31.519 -11.765 11.159 1 1 A LYS 0.410 1 ATOM 40 C CA . LYS 12 12 ? A 32.266 -12.985 11.305 1 1 A LYS 0.410 1 ATOM 41 C C . LYS 12 12 ? A 31.261 -14.079 11.571 1 1 A LYS 0.410 1 ATOM 42 O O . LYS 12 12 ? A 30.597 -14.077 12.610 1 1 A LYS 0.410 1 ATOM 43 C CB . LYS 12 12 ? A 33.243 -12.886 12.492 1 1 A LYS 0.410 1 ATOM 44 C CG . LYS 12 12 ? A 34.001 -14.189 12.784 1 1 A LYS 0.410 1 ATOM 45 C CD . LYS 12 12 ? A 35.132 -13.944 13.790 1 1 A LYS 0.410 1 ATOM 46 C CE . LYS 12 12 ? A 35.790 -15.217 14.320 1 1 A LYS 0.410 1 ATOM 47 N NZ . LYS 12 12 ? A 36.870 -14.844 15.262 1 1 A LYS 0.410 1 ATOM 48 N N . GLU 13 13 ? A 31.117 -15.029 10.634 1 1 A GLU 0.430 1 ATOM 49 C CA . GLU 13 13 ? A 30.088 -16.043 10.677 1 1 A GLU 0.430 1 ATOM 50 C C . GLU 13 13 ? A 30.730 -17.359 10.288 1 1 A GLU 0.430 1 ATOM 51 O O . GLU 13 13 ? A 31.842 -17.398 9.749 1 1 A GLU 0.430 1 ATOM 52 C CB . GLU 13 13 ? A 28.909 -15.723 9.705 1 1 A GLU 0.430 1 ATOM 53 C CG . GLU 13 13 ? A 28.289 -14.314 9.945 1 1 A GLU 0.430 1 ATOM 54 C CD . GLU 13 13 ? A 26.987 -13.930 9.217 1 1 A GLU 0.430 1 ATOM 55 O OE1 . GLU 13 13 ? A 27.069 -13.405 8.077 1 1 A GLU 0.430 1 ATOM 56 O OE2 . GLU 13 13 ? A 25.905 -14.006 9.856 1 1 A GLU 0.430 1 ATOM 57 N N . LEU 14 14 ? A 30.077 -18.496 10.583 1 1 A LEU 0.460 1 ATOM 58 C CA . LEU 14 14 ? A 30.515 -19.797 10.122 1 1 A LEU 0.460 1 ATOM 59 C C . LEU 14 14 ? A 30.406 -19.953 8.617 1 1 A LEU 0.460 1 ATOM 60 O O . LEU 14 14 ? A 29.405 -19.595 7.999 1 1 A LEU 0.460 1 ATOM 61 C CB . LEU 14 14 ? A 29.708 -20.933 10.785 1 1 A LEU 0.460 1 ATOM 62 C CG . LEU 14 14 ? A 29.968 -21.104 12.293 1 1 A LEU 0.460 1 ATOM 63 C CD1 . LEU 14 14 ? A 28.900 -22.020 12.907 1 1 A LEU 0.460 1 ATOM 64 C CD2 . LEU 14 14 ? A 31.378 -21.642 12.577 1 1 A LEU 0.460 1 ATOM 65 N N . LEU 15 15 ? A 31.420 -20.564 7.977 1 1 A LEU 0.460 1 ATOM 66 C CA . LEU 15 15 ? A 31.387 -20.881 6.557 1 1 A LEU 0.460 1 ATOM 67 C C . LEU 15 15 ? A 30.243 -21.811 6.168 1 1 A LEU 0.460 1 ATOM 68 O O . LEU 15 15 ? A 29.649 -21.678 5.105 1 1 A LEU 0.460 1 ATOM 69 C CB . LEU 15 15 ? A 32.734 -21.484 6.114 1 1 A LEU 0.460 1 ATOM 70 C CG . LEU 15 15 ? A 32.828 -21.876 4.624 1 1 A LEU 0.460 1 ATOM 71 C CD1 . LEU 15 15 ? A 32.491 -20.725 3.661 1 1 A LEU 0.460 1 ATOM 72 C CD2 . LEU 15 15 ? A 34.217 -22.445 4.317 1 1 A LEU 0.460 1 ATOM 73 N N . TYR 16 16 ? A 29.880 -22.751 7.064 1 1 A TYR 0.460 1 ATOM 74 C CA . TYR 16 16 ? A 28.723 -23.612 6.930 1 1 A TYR 0.460 1 ATOM 75 C C . TYR 16 16 ? A 27.418 -22.822 6.728 1 1 A TYR 0.460 1 ATOM 76 O O . TYR 16 16 ? A 26.668 -23.089 5.802 1 1 A TYR 0.460 1 ATOM 77 C CB . TYR 16 16 ? A 28.675 -24.488 8.214 1 1 A TYR 0.460 1 ATOM 78 C CG . TYR 16 16 ? A 27.564 -25.498 8.199 1 1 A TYR 0.460 1 ATOM 79 C CD1 . TYR 16 16 ? A 27.728 -26.752 7.592 1 1 A TYR 0.460 1 ATOM 80 C CD2 . TYR 16 16 ? A 26.326 -25.178 8.775 1 1 A TYR 0.460 1 ATOM 81 C CE1 . TYR 16 16 ? A 26.664 -27.665 7.553 1 1 A TYR 0.460 1 ATOM 82 C CE2 . TYR 16 16 ? A 25.259 -26.083 8.722 1 1 A TYR 0.460 1 ATOM 83 C CZ . TYR 16 16 ? A 25.432 -27.332 8.119 1 1 A TYR 0.460 1 ATOM 84 O OH . TYR 16 16 ? A 24.367 -28.252 8.078 1 1 A TYR 0.460 1 ATOM 85 N N . ASP 17 17 ? A 27.178 -21.787 7.565 1 1 A ASP 0.470 1 ATOM 86 C CA . ASP 17 17 ? A 26.012 -20.932 7.473 1 1 A ASP 0.470 1 ATOM 87 C C . ASP 17 17 ? A 26.043 -19.993 6.268 1 1 A ASP 0.470 1 ATOM 88 O O . ASP 17 17 ? A 25.059 -19.857 5.544 1 1 A ASP 0.470 1 ATOM 89 C CB . ASP 17 17 ? A 25.861 -20.127 8.785 1 1 A ASP 0.470 1 ATOM 90 C CG . ASP 17 17 ? A 25.659 -21.075 9.961 1 1 A ASP 0.470 1 ATOM 91 O OD1 . ASP 17 17 ? A 24.907 -22.069 9.813 1 1 A ASP 0.470 1 ATOM 92 O OD2 . ASP 17 17 ? A 26.291 -20.816 11.014 1 1 A ASP 0.470 1 ATOM 93 N N . VAL 18 18 ? A 27.202 -19.342 6.007 1 1 A VAL 0.440 1 ATOM 94 C CA . VAL 18 18 ? A 27.378 -18.417 4.885 1 1 A VAL 0.440 1 ATOM 95 C C . VAL 18 18 ? A 27.248 -19.076 3.525 1 1 A VAL 0.440 1 ATOM 96 O O . VAL 18 18 ? A 26.599 -18.545 2.628 1 1 A VAL 0.440 1 ATOM 97 C CB . VAL 18 18 ? A 28.716 -17.675 4.928 1 1 A VAL 0.440 1 ATOM 98 C CG1 . VAL 18 18 ? A 28.887 -16.717 3.724 1 1 A VAL 0.440 1 ATOM 99 C CG2 . VAL 18 18 ? A 28.787 -16.851 6.221 1 1 A VAL 0.440 1 ATOM 100 N N . ALA 19 19 ? A 27.876 -20.254 3.334 1 1 A ALA 0.510 1 ATOM 101 C CA . ALA 19 19 ? A 27.713 -21.052 2.139 1 1 A ALA 0.510 1 ATOM 102 C C . ALA 19 19 ? A 26.327 -21.676 2.025 1 1 A ALA 0.510 1 ATOM 103 O O . ALA 19 19 ? A 25.724 -21.719 0.961 1 1 A ALA 0.510 1 ATOM 104 C CB . ALA 19 19 ? A 28.768 -22.173 2.118 1 1 A ALA 0.510 1 ATOM 105 N N . GLY 20 20 ? A 25.778 -22.190 3.147 1 1 A GLY 0.520 1 ATOM 106 C CA . GLY 20 20 ? A 24.533 -22.943 3.143 1 1 A GLY 0.520 1 ATOM 107 C C . GLY 20 20 ? A 24.559 -24.163 2.260 1 1 A GLY 0.520 1 ATOM 108 O O . GLY 20 20 ? A 25.361 -25.080 2.450 1 1 A GLY 0.520 1 ATOM 109 N N . SER 21 21 ? A 23.663 -24.204 1.263 1 1 A SER 0.500 1 ATOM 110 C CA . SER 21 21 ? A 23.604 -25.289 0.299 1 1 A SER 0.500 1 ATOM 111 C C . SER 21 21 ? A 24.310 -24.923 -0.993 1 1 A SER 0.500 1 ATOM 112 O O . SER 21 21 ? A 24.361 -25.732 -1.923 1 1 A SER 0.500 1 ATOM 113 C CB . SER 21 21 ? A 22.144 -25.664 -0.060 1 1 A SER 0.500 1 ATOM 114 O OG . SER 21 21 ? A 21.444 -26.142 1.093 1 1 A SER 0.500 1 ATOM 115 N N . ASP 22 22 ? A 24.890 -23.709 -1.090 1 1 A ASP 0.480 1 ATOM 116 C CA . ASP 22 22 ? A 25.561 -23.256 -2.287 1 1 A ASP 0.480 1 ATOM 117 C C . ASP 22 22 ? A 26.983 -23.796 -2.376 1 1 A ASP 0.480 1 ATOM 118 O O . ASP 22 22 ? A 27.704 -23.960 -1.391 1 1 A ASP 0.480 1 ATOM 119 C CB . ASP 22 22 ? A 25.562 -21.712 -2.409 1 1 A ASP 0.480 1 ATOM 120 C CG . ASP 22 22 ? A 24.132 -21.205 -2.521 1 1 A ASP 0.480 1 ATOM 121 O OD1 . ASP 22 22 ? A 23.354 -21.833 -3.286 1 1 A ASP 0.480 1 ATOM 122 O OD2 . ASP 22 22 ? A 23.809 -20.180 -1.872 1 1 A ASP 0.480 1 ATOM 123 N N . LYS 23 23 ? A 27.423 -24.134 -3.604 1 1 A LYS 0.400 1 ATOM 124 C CA . LYS 23 23 ? A 28.789 -24.541 -3.884 1 1 A LYS 0.400 1 ATOM 125 C C . LYS 23 23 ? A 29.791 -23.410 -3.734 1 1 A LYS 0.400 1 ATOM 126 O O . LYS 23 23 ? A 29.508 -22.257 -4.055 1 1 A LYS 0.400 1 ATOM 127 C CB . LYS 23 23 ? A 28.924 -25.145 -5.302 1 1 A LYS 0.400 1 ATOM 128 C CG . LYS 23 23 ? A 28.141 -26.456 -5.451 1 1 A LYS 0.400 1 ATOM 129 C CD . LYS 23 23 ? A 28.092 -26.980 -6.895 1 1 A LYS 0.400 1 ATOM 130 C CE . LYS 23 23 ? A 27.230 -28.241 -7.019 1 1 A LYS 0.400 1 ATOM 131 N NZ . LYS 23 23 ? A 27.083 -28.639 -8.438 1 1 A LYS 0.400 1 ATOM 132 N N . TYR 24 24 ? A 31.018 -23.711 -3.281 1 1 A TYR 0.420 1 ATOM 133 C CA . TYR 24 24 ? A 32.013 -22.689 -3.083 1 1 A TYR 0.420 1 ATOM 134 C C . TYR 24 24 ? A 33.359 -23.303 -3.367 1 1 A TYR 0.420 1 ATOM 135 O O . TYR 24 24 ? A 33.482 -24.519 -3.492 1 1 A TYR 0.420 1 ATOM 136 C CB . TYR 24 24 ? A 31.946 -22.055 -1.658 1 1 A TYR 0.420 1 ATOM 137 C CG . TYR 24 24 ? A 32.202 -23.046 -0.544 1 1 A TYR 0.420 1 ATOM 138 C CD1 . TYR 24 24 ? A 33.501 -23.248 -0.049 1 1 A TYR 0.420 1 ATOM 139 C CD2 . TYR 24 24 ? A 31.148 -23.784 0.019 1 1 A TYR 0.420 1 ATOM 140 C CE1 . TYR 24 24 ? A 33.739 -24.173 0.977 1 1 A TYR 0.420 1 ATOM 141 C CE2 . TYR 24 24 ? A 31.383 -24.695 1.059 1 1 A TYR 0.420 1 ATOM 142 C CZ . TYR 24 24 ? A 32.681 -24.885 1.543 1 1 A TYR 0.420 1 ATOM 143 O OH . TYR 24 24 ? A 32.933 -25.778 2.604 1 1 A TYR 0.420 1 ATOM 144 N N . GLN 25 25 ? A 34.400 -22.465 -3.488 1 1 A GLN 0.710 1 ATOM 145 C CA . GLN 25 25 ? A 35.747 -22.931 -3.678 1 1 A GLN 0.710 1 ATOM 146 C C . GLN 25 25 ? A 36.655 -21.892 -3.071 1 1 A GLN 0.710 1 ATOM 147 O O . GLN 25 25 ? A 36.258 -20.732 -2.929 1 1 A GLN 0.710 1 ATOM 148 C CB . GLN 25 25 ? A 36.110 -23.112 -5.179 1 1 A GLN 0.710 1 ATOM 149 C CG . GLN 25 25 ? A 36.122 -21.804 -6.013 1 1 A GLN 0.710 1 ATOM 150 C CD . GLN 25 25 ? A 36.377 -22.083 -7.497 1 1 A GLN 0.710 1 ATOM 151 O OE1 . GLN 25 25 ? A 36.638 -23.199 -7.930 1 1 A GLN 0.710 1 ATOM 152 N NE2 . GLN 25 25 ? A 36.281 -21.013 -8.328 1 1 A GLN 0.710 1 ATOM 153 N N . VAL 26 26 ? A 37.883 -22.278 -2.681 1 1 A VAL 0.670 1 ATOM 154 C CA . VAL 26 26 ? A 39.002 -21.368 -2.479 1 1 A VAL 0.670 1 ATOM 155 C C . VAL 26 26 ? A 39.432 -20.824 -3.840 1 1 A VAL 0.670 1 ATOM 156 O O . VAL 26 26 ? A 39.497 -21.579 -4.813 1 1 A VAL 0.670 1 ATOM 157 C CB . VAL 26 26 ? A 40.159 -22.085 -1.778 1 1 A VAL 0.670 1 ATOM 158 C CG1 . VAL 26 26 ? A 41.410 -21.192 -1.659 1 1 A VAL 0.670 1 ATOM 159 C CG2 . VAL 26 26 ? A 39.708 -22.546 -0.376 1 1 A VAL 0.670 1 ATOM 160 N N . ASN 27 27 ? A 39.702 -19.521 -3.956 1 1 A ASN 0.620 1 ATOM 161 C CA . ASN 27 27 ? A 40.199 -18.854 -5.128 1 1 A ASN 0.620 1 ATOM 162 C C . ASN 27 27 ? A 40.929 -17.621 -4.493 1 1 A ASN 0.620 1 ATOM 163 O O . ASN 27 27 ? A 40.854 -17.497 -3.231 1 1 A ASN 0.620 1 ATOM 164 C CB . ASN 27 27 ? A 39.012 -18.449 -6.055 1 1 A ASN 0.620 1 ATOM 165 C CG . ASN 27 27 ? A 39.403 -18.159 -7.504 1 1 A ASN 0.620 1 ATOM 166 O OD1 . ASN 27 27 ? A 40.498 -18.394 -8.008 1 1 A ASN 0.620 1 ATOM 167 N ND2 . ASN 27 27 ? A 38.384 -17.677 -8.272 1 1 A ASN 0.620 1 ATOM 168 O OXT . ASN 27 27 ? A 41.536 -16.813 -5.234 1 1 A ASN 0.620 1 # # loop_ _atom_type.symbol C N O # # loop_ _ma_qa_metric.id _ma_qa_metric.name _ma_qa_metric.description _ma_qa_metric.type _ma_qa_metric.mode _ma_qa_metric.type_other_details _ma_qa_metric.software_group_id 1 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].' 'pLDDT all-atom in [0,1]' local . 5 2 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].' 'pLDDT all-atom in [0,1]' global . 5 3 GMQE 'Global Model Quality Estimate of the model accuracy, calculated by SWISS-MODEL.' 'normalized score' global . 6 # # loop_ _ma_qa_metric_global.ordinal_id _ma_qa_metric_global.model_id _ma_qa_metric_global.metric_id _ma_qa_metric_global.metric_value 1 1 2 0.519 2 1 3 0.374 # # loop_ _ma_qa_metric_local.ordinal_id _ma_qa_metric_local.model_id _ma_qa_metric_local.label_asym_id _ma_qa_metric_local.label_seq_id _ma_qa_metric_local.label_comp_id _ma_qa_metric_local.metric_id _ma_qa_metric_local.metric_value 1 1 A 7 LYS 1 0.640 2 1 A 8 ALA 1 0.660 3 1 A 9 ILE 1 0.460 4 1 A 10 VAL 1 0.590 5 1 A 11 LYS 1 0.590 6 1 A 12 LYS 1 0.410 7 1 A 13 GLU 1 0.430 8 1 A 14 LEU 1 0.460 9 1 A 15 LEU 1 0.460 10 1 A 16 TYR 1 0.460 11 1 A 17 ASP 1 0.470 12 1 A 18 VAL 1 0.440 13 1 A 19 ALA 1 0.510 14 1 A 20 GLY 1 0.520 15 1 A 21 SER 1 0.500 16 1 A 22 ASP 1 0.480 17 1 A 23 LYS 1 0.400 18 1 A 24 TYR 1 0.420 19 1 A 25 GLN 1 0.710 20 1 A 26 VAL 1 0.670 21 1 A 27 ASN 1 0.620 # # loop_ _pdbx_data_usage.id _pdbx_data_usage.type _pdbx_data_usage.details _pdbx_data_usage.url 1 license ;This SWISS-MODEL protein model is copyright. It is produced by the SWISS-MODEL server, developed by the Computational Structural Biology Group at the SIB Swiss Institute of Bioinformatics at the Biozentrum, University of Basel (https://swissmodel.expasy.org). This model is licensed under the CC BY-SA 4.0 Creative Commons Attribution-ShareAlike 4.0 International License (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you can copy and redistribute the model in any medium or format, transform and build upon the model for any purpose, even commercially, under the following terms: Attribution - You must give appropriate credit, provide a link to the license, and indicate if changes were made. You may do so in any reasonable manner, but not in any way that suggests the licensor endorses you or your use. When you publish, patent or distribute results that were fully or partially based on the model, please cite the corresponding papers mentioned under JRNL. ShareAlike - If you remix, transform, or build upon the material, you must distribute your contributions under the same license as the original. No additional restrictions - you may not apply legal terms or technological measures that legally restrict others from doing anything the license permits. Find a human-readable summary of (and not a substitute for) the CC BY-SA 4.0 license at this link: https://creativecommons.org/licenses/by-sa/4.0/ ; https://creativecommons.org/licenses/by-sa/4.0/legalcode 2 disclaimer ;The SWISS-MODEL SERVER produces theoretical models for proteins. The results of any theoretical modelling procedure is NON-EXPERIMENTAL and MUST be considered with care. These models may contain significant errors. This is especially true for automated modeling since there is no human intervention during model building. Please read the header section and the logfile carefully to know what templates and alignments were used during the model building process. All information by the SWISS-MODEL SERVER is provided "AS-IS", without any warranty, expressed or implied. ; https://swissmodel.expasy.org/docs/terms_of_use#disclaimer #