data_SMR-db2666bfd81ead3216879eedf5b6b31c_1
_entry.id SMR-db2666bfd81ead3216879eedf5b6b31c_1
_struct.entry_id SMR-db2666bfd81ead3216879eedf5b6b31c_1
_struct.pdbx_model_details
;This model was generated unsupervised by the SWISS-MODEL homology-modelling pipeline for the SWISS-MODEL Repository, a database of annotated 3D protein structure models. The modelled monomer covers following UniProtKB entries:

  - P85800/ VARI_AMBVA, Variegin

Estimated model accuracy of this model is 0.365, calculated by SWISS-MODEL as Global Model Quality Estimate (GMQE).
;
_struct.pdbx_structure_determination_methodology computational
_struct.title 'Model for UniProtKB entries P85800'
_audit_conform.dict_location https://raw.githubusercontent.com/ihmwg/ModelCIF/80e1e22/dist/mmcif_ma.dic
_audit_conform.dict_name mmcif_ma.dic
_audit_conform.dict_version 1.4.7
#
loop_
_citation.id
_citation.title
_citation.journal_abbrev
_citation.journal_volume
_citation.page_first
_citation.page_last
_citation.year
_citation.pdbx_database_id_PubMed
_citation.pdbx_database_id_DOI
primary 'The SWISS-MODEL Repository - new features and functionality'
'Nucleic Acids Res.' 45 D313 D319 2017 27899672 10.1093/nar/gkw1132
2 'SWISS-MODEL: homology modelling of protein structures and complexes'
'Nucleic Acids Res.' 46 W296 W303 2018 29788355 10.1093/nar/gky427
3 'ProMod3 - A versatile homology modelling toolbox' 'PLoS Comput. Biol.' 17(1)
1 18 2021 33507980 10.1371/journal.pcbi.1008667
4 'QMEANDisCo - distance constraints applied on model quality estimation'
Bioinformatics 36 1765 1771 2020 31697312 10.1093/bioinformatics/btz828
5
'OpenStructure: an integrated software framework for computational structural biology'
'Acta Crystallogr., Sect. D: Biol. Crystallogr.' 69 701 709 2013 23633579
10.1107/S0907444913007051
6 'BLAST+: architecture and applications' 'BMC Bioinf.' 10 421 . 2009 20003500
10.1186/1471-2105-10-421
7 'HH-suite3 for fast remote homology detection and deep protein annotation'
'BMC Bioinf.' 20 473 . 2019 31521110 10.1186/s12859-019-3019-7
#
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
primary 'Bienert, S.' 1
primary 'Waterhouse, A.' 2
primary 'de Beer, T.A.P.' 3
primary 'Tauriello, G.' 4
primary 'Studer, G.' 5
primary 'Bordoli, L.' 6
primary 'Schwede, T.' 7
2 'Waterhouse, A.' 8
2 'Bertoni, M.' 9
2 'Bienert, S.' 10
2 'Studer, G.' 11
2 'Tauriello, G.' 12
2 'Gumienny, R.' 13
2 'Heer, F.T.' 14
2 'de Beer, T.A.P.' 15
2 'Rempfer, C.' 16
2 'Bordoli, L.' 17
2 'Lepore, R.' 18
2 'Schwede, T.' 19
3 'Studer, G.' 20
3 'Tauriello, G.' 21
3 'Bienert, S.' 22
3 'Biasini, M.' 23
3 'Johner, N.' 24
3 'Schwede, T.' 25
4 'Studer, G.' 26
4 'Rempfer, C.' 27
4 'Waterhouse, A.M.' 28
4 'Gumienny, R.' 29
4 'Haas, J.' 30
4 'Schwede, T.' 31
5 'Biasini, M.' 32
5 'Schmidt, T.' 33
5 'Bienert, S.' 34
5 'Mariani, V.' 35
5 'Studer, G.' 36
5 'Haas, J.' 37
5 'Johner, N.' 38
5 'Schenk, A.D.' 39
5 'Philippsen, A.' 40
5 'Schwede, T.' 41
6 'Camacho, C.' 42
6 'Coulouris, G.' 43
6 'Avagyan, V.' 44
6 'Ma, N.' 45
6 'Papadopoulos, J.' 46
6 'Bealer, K.' 47
6 'Madden, T.L.' 48
7 'Steinegger, M.' 49
7 'Meier, M.' 50
7 'Mirdita, M.' 51
7 'Vohringer, H.' 52
7 'Haunsberger, S.J.' 53
7 'Soding, J.' 54
#
#
loop_
_software.pdbx_ordinal
_software.name
_software.classification
_software.description
_software.version
_software.type
_software.location
_software.citation_id
1 SWISS-MODEL 'model building' 'Homology modelling web service' 2025-06.3
package https://swissmodel.expasy.org 2
2 ProMod3 'model building' 'Modular homology modelling engine' 3.5.0 library
https://git.scicore.unibas.ch/schwede/ProMod3 3
3 QMEAN 'model building' 'QMEAN - Qualitative Model Energy ANalysis' 4.4.0
library https://git.scicore.unibas.ch/schwede/QMEAN 4
4 OpenStructure 'data processing'
'Open-Source Computational Structural Biology Framework' 2.10.0 package
https://openstructure.org/ 5
5 BLAST 'data collection' . 2.14.1 package https://blast.ncbi.nlm.nih.gov 6
6 HH-suite 'data collection' 'HH-suite3 for sensitive sequence searching' 3.2.0
package https://github.com/soedinglab/hh-suite 7
#
#
loop_
_ma_software_group.ordinal_id
_ma_software_group.group_id
_ma_software_group.software_id
_ma_software_group.parameter_group_id
1 1 6 .
2 2 1 .
3 2 4 .
4 2 5 .
5 2 6 .
6 3 1 .
7 3 4 .
8 4 1 .
9 4 2 .
10 4 4 .
11 5 3 .
12 6 1 .
13 6 3 .
14 6 4 .
#
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
'Bienert, S.' 1
'Waterhouse, A.' 2
'de Beer, T.A.P.' 3
'Tauriello, G.' 4
'Studer, G.' 5
'Bordoli, L.' 6
'Schwede, T.' 7
#
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.name
_chem_comp.formula
_chem_comp.formula_weight
_chem_comp.ma_provenance
ALA 'L-peptide linking' ALANINE 'C3 H7 N O2' 89.094 'CCD Core'
ASP 'L-peptide linking' 'ASPARTIC ACID' 'C4 H7 N O4' 133.103 'CCD Core'
GLN 'L-peptide linking' GLUTAMINE 'C5 H10 N2 O3' 146.146 'CCD Core'
GLU 'L-peptide linking' 'GLUTAMIC ACID' 'C5 H9 N O4' 147.130 'CCD Core'
GLY 'peptide linking' GLYCINE 'C2 H5 N O2' 75.067 'CCD Core'
HIS 'L-peptide linking' HISTIDINE 'C6 H10 N3 O2 1' 156.165 'CCD Core'
ILE 'L-peptide linking' ISOLEUCINE 'C6 H13 N O2' 131.175 'CCD Core'
LEU 'L-peptide linking' LEUCINE 'C6 H13 N O2' 131.175 'CCD Core'
LYS 'L-peptide linking' LYSINE 'C6 H15 N2 O2 1' 147.198 'CCD Core'
MET 'L-peptide linking' METHIONINE 'C5 H11 N O2 S' 149.208 'CCD Core'
PHE 'L-peptide linking' PHENYLALANINE 'C9 H11 N O2' 165.192 'CCD Core'
PRO 'L-peptide linking' PROLINE 'C5 H9 N O2' 115.132 'CCD Core'
SER 'L-peptide linking' SERINE 'C3 H7 N O3' 105.093 'CCD Core'
THR 'L-peptide linking' THREONINE 'C4 H9 N O3' 119.120 'CCD Core'
TYR 'L-peptide linking' TYROSINE 'C9 H11 N O3' 181.191 'CCD Core'
VAL 'L-peptide linking' VALINE 'C5 H11 N O2' 117.148 'CCD Core'
#
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.details
1 polymer man . 4170.336 1 .
#
#
loop_
_struct_ref.id
_struct_ref.entity_id
_struct_ref.db_name
_struct_ref.db_code
_struct_ref.pdbx_db_accession
_struct_ref.pdbx_align_begin
_struct_ref.pdbx_seq_one_letter_code
_struct_ref.details
1 1 UNP VARI_AMBVA P85800 1 SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES Variegin
#
#
loop_
_struct_ref_seq.align_id
_struct_ref_seq.ref_id
_struct_ref_seq.seq_align_beg
_struct_ref_seq.seq_align_end
_struct_ref_seq.db_align_beg
_struct_ref_seq.db_align_end
1 1 1 32 1 32
#
#
loop_
_ma_target_ref_db_details.target_entity_id
_ma_target_ref_db_details.db_name
_ma_target_ref_db_details.db_name_other_details
_ma_target_ref_db_details.db_code
_ma_target_ref_db_details.db_accession
_ma_target_ref_db_details.seq_db_isoform
_ma_target_ref_db_details.seq_db_align_begin
_ma_target_ref_db_details.seq_db_align_end
_ma_target_ref_db_details.ncbi_taxonomy_id
_ma_target_ref_db_details.organism_scientific
_ma_target_ref_db_details.seq_db_sequence_version_date
_ma_target_ref_db_details.seq_db_sequence_checksum
_ma_target_ref_db_details.is_primary
1 UNP . VARI_AMBVA P85800 . 1 32 34610
'Amblyomma variegatum (Tropical bont tick)' 2008-06-10 22448E8203FC70E2 .
#
#
loop_
_entity_poly.entity_id
_entity_poly.type
_entity_poly.nstd_linkage
_entity_poly.nstd_monomer
_entity_poly.pdbx_strand_id
_entity_poly.pdbx_seq_one_letter_code
_entity_poly.pdbx_seq_one_letter_code_can
1 polypeptide(L) no no C SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES
SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES
#
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 SER .
1 2 ASP .
1 3 GLN .
1 4 GLY .
1 5 ASP .
1 6 VAL .
1 7 ALA .
1 8 GLU .
1 9 PRO .
1 10 LYS .
1 11 MET .
1 12 HIS .
1 13 LYS .
1 14 THR .
1 15 ALA .
1 16 PRO .
1 17 PRO .
1 18 PHE .
1 19 ASP .
1 20 PHE .
1 21 GLU .
1 22 ALA .
1 23 ILE .
1 24 PRO .
1 25 GLU .
1 26 GLU .
1 27 TYR .
1 28 LEU .
1 29 ASP .
1 30 ASP .
1 31 GLU .
1 32 SER .
#
#
loop_
_struct_asym.id
_struct_asym.entity_id
_struct_asym.details
A 1 .
#
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
A 1 1 SER 1 ? ? ? C .
A 1 2 ASP 2 ? ? ? C .
A 1 3 GLN 3 ? ? ? C .
A 1 4 GLY 4 ? ? ? C .
A 1 5 ASP 5 ? ? ? C .
A 1 6 VAL 6 ? ? ? C .
A 1 7 ALA 7 ? ? ? C .
A 1 8 GLU 8 ? ? ? C .
A 1 9 PRO 9 ? ? ? C .
A 1 10 LYS 10 ? ? ? C .
A 1 11 MET 11 ? ? ? C .
A 1 12 HIS 12 12 HIS HIS C .
A 1 13 LYS 13 13 LYS LYS C .
A 1 14 THR 14 14 THR THR C .
A 1 15 ALA 15 15 ALA ALA C .
A 1 16 PRO 16 16 PRO PRO C .
A 1 17 PRO 17 17 PRO PRO C .
A 1 18 PHE 18 18 PHE PHE C .
A 1 19 ASP 19 19 ASP ASP C .
A 1 20 PHE 20 20 PHE PHE C .
A 1 21 GLU 21 21 GLU GLU C .
A 1 22 ALA 22 22 ALA ALA C .
A 1 23 ILE 23 23 ILE ILE C .
A 1 24 PRO 24 24 PRO PRO C .
A 1 25 GLU 25 25 GLU GLU C .
A 1 26 GLU 26 26 GLU GLU C .
A 1 27 TYR 27 27 TYR TYR C .
A 1 28 LEU 28 28 LEU LEU C .
A 1 29 ASP 29 ? ? ? C .
A 1 30 ASP 30 ? ? ? C .
A 1 31 GLU 31 ? ? ? C .
A 1 32 SER 32 ? ? ? C .
#
#
loop_
_ma_data.id
_ma_data.name
_ma_data.content_type
_ma_data.content_type_other_details
1 'Variegin {PDB ID=3b23, label_asym_id=C, auth_asym_id=C, SMTL ID=3b23.1.C}'
'template structure' .
2 . target .
3 'Target-template alignment by HHblits to 3b23, label_asym_id=C'
'target-template alignment' .
4 'model 1' 'model coordinates' .
5 SMTL 'reference database' .
6 PDB 'reference database' .
7 'Template search output' other 'Results of the sequence search'
#
#
loop_
_ma_data_group.ordinal_id
_ma_data_group.group_id
_ma_data_group.data_id
1 1 2
2 1 5
3 1 6
4 2 7
5 3 2
6 3 1
7 3 3
8 4 1
9 4 3
10 5 4
#
#
loop_
_ma_data_ref_db.data_id
_ma_data_ref_db.name
_ma_data_ref_db.location_url
_ma_data_ref_db.version
_ma_data_ref_db.release_date
5 SMTL https://swissmodel.expasy.org/templates/ . 2025-06-25
6 PDB https://www.wwpdb.org . 2025-06-20
#
#
loop_
_ma_target_entity.entity_id
_ma_target_entity.data_id
_ma_target_entity.origin
1 2 'reference database'
#
#
loop_
_ma_target_entity_instance.asym_id
_ma_target_entity_instance.entity_id
_ma_target_entity_instance.details
A 1 .
#
#
loop_
_ma_template_trans_matrix.id
_ma_template_trans_matrix.rot_matrix[1][1]
_ma_template_trans_matrix.rot_matrix[2][1]
_ma_template_trans_matrix.rot_matrix[3][1]
_ma_template_trans_matrix.rot_matrix[1][2]
_ma_template_trans_matrix.rot_matrix[2][2]
_ma_template_trans_matrix.rot_matrix[3][2]
_ma_template_trans_matrix.rot_matrix[1][3]
_ma_template_trans_matrix.rot_matrix[2][3]
_ma_template_trans_matrix.rot_matrix[3][3]
_ma_template_trans_matrix.tr_vector[1]
_ma_template_trans_matrix.tr_vector[2]
_ma_template_trans_matrix.tr_vector[3]
1 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000
1.000000 0 0 0
#
#
loop_
_ma_template_details.ordinal_id
_ma_template_details.template_id
_ma_template_details.template_origin
_ma_template_details.template_entity_type
_ma_template_details.template_trans_matrix_id
_ma_template_details.template_data_id
_ma_template_details.target_asym_id
_ma_template_details.template_label_asym_id
_ma_template_details.template_label_entity_id
_ma_template_details.template_model_num
_ma_template_details.template_auth_asym_id
1 1 'reference database' polymer 1 1 A C 3 1 C
#
#
loop_
_ma_template_poly.template_id
_ma_template_poly.seq_one_letter_code
_ma_template_poly.seq_one_letter_code_can
1 SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES
#
#
loop_
_ma_template_poly_segment.id
_ma_template_poly_segment.template_id
_ma_template_poly_segment.residue_number_begin
_ma_template_poly_segment.residue_number_end
1 1 1 32
#
#
loop_
_ma_template_ref_db_details.template_id
_ma_template_ref_db_details.db_name
_ma_template_ref_db_details.db_name_other_details
_ma_template_ref_db_details.db_accession_code
_ma_template_ref_db_details.db_version_date
1 PDB . 3b23 2024-11-06
#
#
loop_
_ma_target_template_poly_mapping.id
_ma_target_template_poly_mapping.template_segment_id
_ma_target_template_poly_mapping.target_asym_id
_ma_target_template_poly_mapping.target_seq_id_begin
_ma_target_template_poly_mapping.target_seq_id_end
1 1 A 1 32
#
#
loop_
_ma_alignment_info.alignment_id
_ma_alignment_info.data_id
_ma_alignment_info.software_group_id
_ma_alignment_info.alignment_length
_ma_alignment_info.alignment_type
_ma_alignment_info.alignment_mode
1 3 1 32 'target-template pairwise alignment' local
#
#
loop_
_ma_alignment_details.ordinal_id
_ma_alignment_details.alignment_id
_ma_alignment_details.template_segment_id
_ma_alignment_details.target_asym_id
_ma_alignment_details.score_type
_ma_alignment_details.score_type_other_details
_ma_alignment_details.score_value
_ma_alignment_details.percent_sequence_identity
_ma_alignment_details.sequence_identity_denominator
_ma_alignment_details.sequence_identity_denominator_other_details
1 1 1 A 'HHblits e-value' . 3.7e-23 100.000
'Number of aligned residue pairs (not including the gaps)' .
#
#
loop_
_ma_alignment.ordinal_id
_ma_alignment.alignment_id
_ma_alignment.target_template_flag
_ma_alignment.sequence
1 1 1 SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES
2 1 2 SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES
#
#
loop_
_ma_protocol_step.ordinal_id
_ma_protocol_step.protocol_id
_ma_protocol_step.step_id
_ma_protocol_step.method_type
_ma_protocol_step.step_name
_ma_protocol_step.details
_ma_protocol_step.software_group_id
_ma_protocol_step.input_data_group_id
_ma_protocol_step.output_data_group_id
1 1 1 'template search' 'template search' 'SWISS-MODEL template search in PDB' 2
1 2
2 1 2 'template selection' 'template selection'
'Automatic template selection by SWISS-MODEL {QSQE=0.000}' 3 2 4
3 1 3 modeling 'homology modeling'
'SWISS-MODEL auto-model mode using ProMod3 on 3b23.1' 4 3 5
#
#
loop_
_ma_model_list.ordinal_id
_ma_model_list.model_name
_ma_model_list.data_id
_ma_model_list.model_type
_ma_model_list.model_type_other_details
1 'model 1' 4 'Homology model' .
#
#
loop_
_ma_model_group.id
_ma_model_group.name
_ma_model_group.details
1 . .
#
#
loop_
_ma_model_group_link.group_id
_ma_model_group_link.model_id
1 1
#
#
loop_
_atom_site.group_PDB
_atom_site.id
_atom_site.type_symbol
_atom_site.label_atom_id
_atom_site.label_alt_id
_atom_site.label_comp_id
_atom_site.label_seq_id
_atom_site.auth_seq_id
_atom_site.pdbx_PDB_ins_code
_atom_site.label_asym_id
_atom_site.Cartn_x
_atom_site.Cartn_y
_atom_site.Cartn_z
_atom_site.occupancy
_atom_site.label_entity_id
_atom_site.auth_asym_id
_atom_site.auth_comp_id
_atom_site.B_iso_or_equiv
_atom_site.pdbx_PDB_model_num
ATOM 1 N N . HIS 12 12 ? A 28.002 -8.013 26.859 1 1 C HIS 0.450 1
ATOM 2 C CA . HIS 12 12 ? A 27.184 -6.831 26.379 1 1 C HIS 0.450 1
ATOM 3 C C . HIS 12 12 ? A 25.959 -6.418 27.204 1 1 C HIS 0.450 1
ATOM 4 O O . HIS 12 12 ? A 24.853 -6.355 26.670 1 1 C HIS 0.450 1
ATOM 5 C CB . HIS 12 12 ? A 26.738 -7.068 24.918 1 1 C HIS 0.450 1
ATOM 6 C CG . HIS 12 12 ? A 26.285 -5.812 24.233 1 1 C HIS 0.450 1
ATOM 7 N ND1 . HIS 12 12 ? A 27.269 -4.986 23.748 1 1 C HIS 0.450 1
ATOM 8 C CD2 . HIS 12 12 ? A 25.047 -5.395 23.831 1 1 C HIS 0.450 1
ATOM 9 C CE1 . HIS 12 12 ? A 26.625 -4.085 23.013 1 1 C HIS 0.450 1
ATOM 10 N NE2 . HIS 12 12 ? A 25.287 -4.287 23.041 1 1 C HIS 0.450 1
ATOM 11 N N . LYS 13 13 ? A 26.104 -6.094 28.508 1 1 C LYS 0.460 1
ATOM 12 C CA . LYS 13 13 ? A 25.106 -5.325 29.274 1 1 C LYS 0.460 1
ATOM 13 C C . LYS 13 13 ? A 23.846 -6.109 29.683 1 1 C LYS 0.460 1
ATOM 14 O O . LYS 13 13 ? A 22.799 -5.522 29.953 1 1 C LYS 0.460 1
ATOM 15 C CB . LYS 13 13 ? A 24.756 -3.882 28.737 1 1 C LYS 0.460 1
ATOM 16 C CG . LYS 13 13 ? A 25.688 -3.171 27.709 1 1 C LYS 0.460 1
ATOM 17 C CD . LYS 13 13 ? A 27.189 -2.999 28.051 1 1 C LYS 0.460 1
ATOM 18 C CE . LYS 13 13 ? A 28.051 -2.703 26.802 1 1 C LYS 0.460 1
ATOM 19 N NZ . LYS 13 13 ? A 29.491 -3.009 27.030 1 1 C LYS 0.460 1
ATOM 20 N N . THR 14 14 ? A 23.905 -7.453 29.773 1 1 C THR 0.600 1
ATOM 21 C CA . THR 14 14 ? A 22.724 -8.286 29.963 1 1 C THR 0.600 1
ATOM 22 C C . THR 14 14 ? A 23.171 -9.590 30.631 1 1 C THR 0.600 1
ATOM 23 O O . THR 14 14 ? A 23.819 -10.414 29.977 1 1 C THR 0.600 1
ATOM 24 C CB . THR 14 14 ? A 21.971 -8.497 28.625 1 1 C THR 0.600 1
ATOM 25 O OG1 . THR 14 14 ? A 20.835 -9.341 28.755 1 1 C THR 0.600 1
ATOM 26 C CG2 . THR 14 14 ? A 22.820 -9.070 27.473 1 1 C THR 0.600 1
ATOM 27 N N . ALA 15 15 ? A 22.908 -9.788 31.950 1 1 C ALA 0.490 1
ATOM 28 C CA . ALA 15 15 ? A 23.266 -10.997 32.701 1 1 C ALA 0.490 1
ATOM 29 C C . ALA 15 15 ? A 23.034 -10.817 34.217 1 1 C ALA 0.490 1
ATOM 30 O O . ALA 15 15 ? A 23.397 -9.781 34.756 1 1 C ALA 0.490 1
ATOM 31 C CB . ALA 15 15 ? A 24.759 -11.393 32.611 1 1 C ALA 0.490 1
ATOM 32 N N . PRO 16 16 ? A 22.430 -11.781 34.931 1 1 C PRO 0.490 1
ATOM 33 C CA . PRO 16 16 ? A 22.577 -11.927 36.387 1 1 C PRO 0.490 1
ATOM 34 C C . PRO 16 16 ? A 23.859 -12.698 36.793 1 1 C PRO 0.490 1
ATOM 35 O O . PRO 16 16 ? A 24.630 -13.060 35.915 1 1 C PRO 0.490 1
ATOM 36 C CB . PRO 16 16 ? A 21.313 -12.729 36.798 1 1 C PRO 0.490 1
ATOM 37 C CG . PRO 16 16 ? A 20.482 -12.965 35.523 1 1 C PRO 0.490 1
ATOM 38 C CD . PRO 16 16 ? A 21.447 -12.703 34.371 1 1 C PRO 0.490 1
ATOM 39 N N . PRO 17 17 ? A 24.144 -12.966 38.081 1 1 C PRO 0.660 1
ATOM 40 C CA . PRO 17 17 ? A 25.243 -13.862 38.492 1 1 C PRO 0.660 1
ATOM 41 C C . PRO 17 17 ? A 24.918 -15.358 38.434 1 1 C PRO 0.660 1
ATOM 42 O O . PRO 17 17 ? A 23.834 -15.742 38.873 1 1 C PRO 0.660 1
ATOM 43 C CB . PRO 17 17 ? A 25.497 -13.477 39.971 1 1 C PRO 0.660 1
ATOM 44 C CG . PRO 17 17 ? A 24.880 -12.082 40.123 1 1 C PRO 0.660 1
ATOM 45 C CD . PRO 17 17 ? A 23.665 -12.147 39.199 1 1 C PRO 0.660 1
ATOM 46 N N . PHE 18 18 ? A 25.854 -16.219 37.957 1 1 C PHE 0.520 1
ATOM 47 C CA . PHE 18 18 ? A 25.765 -17.698 37.920 1 1 C PHE 0.520 1
ATOM 48 C C . PHE 18 18 ? A 24.552 -18.178 37.123 1 1 C PHE 0.520 1
ATOM 49 O O . PHE 18 18 ? A 23.865 -19.142 37.450 1 1 C PHE 0.520 1
ATOM 50 C CB . PHE 18 18 ? A 25.900 -18.400 39.321 1 1 C PHE 0.520 1
ATOM 51 C CG . PHE 18 18 ? A 26.474 -19.812 39.221 1 1 C PHE 0.520 1
ATOM 52 C CD1 . PHE 18 18 ? A 27.807 -20.012 38.804 1 1 C PHE 0.520 1
ATOM 53 C CD2 . PHE 18 18 ? A 25.708 -20.942 39.581 1 1 C PHE 0.520 1
ATOM 54 C CE1 . PHE 18 18 ? A 28.361 -21.302 38.754 1 1 C PHE 0.520 1
ATOM 55 C CE2 . PHE 18 18 ? A 26.262 -22.233 39.540 1 1 C PHE 0.520 1
ATOM 56 C CZ . PHE 18 18 ? A 27.590 -22.411 39.129 1 1 C PHE 0.520 1
ATOM 57 N N . ASP 19 19 ? A 24.284 -17.446 36.037 1 1 C ASP 0.490 1
ATOM 58 C CA . ASP 19 19 ? A 23.084 -17.468 35.244 1 1 C ASP 0.490 1
ATOM 59 C C . ASP 19 19 ? A 23.010 -18.562 34.194 1 1 C ASP 0.490 1
ATOM 60 O O . ASP 19 19 ? A 21.991 -19.238 34.048 1 1 C ASP 0.490 1
ATOM 61 C CB . ASP 19 19 ? A 22.940 -16.068 34.581 1 1 C ASP 0.490 1
ATOM 62 C CG . ASP 19 19 ? A 24.181 -15.530 33.861 1 1 C ASP 0.490 1
ATOM 63 O OD1 . ASP 19 19 ? A 25.313 -16.043 34.085 1 1 C ASP 0.490 1
ATOM 64 O OD2 . ASP 19 19 ? A 23.986 -14.582 33.065 1 1 C ASP 0.490 1
ATOM 65 N N . PHE 20 20 ? A 24.085 -18.762 33.420 1 1 C PHE 0.460 1
ATOM 66 C CA . PHE 20 20 ? A 24.062 -19.673 32.292 1 1 C PHE 0.460 1
ATOM 67 C C . PHE 20 20 ? A 24.450 -21.086 32.701 1 1 C PHE 0.460 1
ATOM 68 O O . PHE 20 20 ? A 25.459 -21.332 33.360 1 1 C PHE 0.460 1
ATOM 69 C CB . PHE 20 20 ? A 24.991 -19.204 31.137 1 1 C PHE 0.460 1
ATOM 70 C CG . PHE 20 20 ? A 24.386 -18.010 30.444 1 1 C PHE 0.460 1
ATOM 71 C CD1 . PHE 20 20 ? A 24.711 -16.708 30.856 1 1 C PHE 0.460 1
ATOM 72 C CD2 . PHE 20 20 ? A 23.471 -18.182 29.386 1 1 C PHE 0.460 1
ATOM 73 C CE1 . PHE 20 20 ? A 24.125 -15.593 30.238 1 1 C PHE 0.460 1
ATOM 74 C CE2 . PHE 20 20 ? A 22.897 -17.068 28.753 1 1 C PHE 0.460 1
ATOM 75 C CZ . PHE 20 20 ? A 23.221 -15.773 29.184 1 1 C PHE 0.460 1
ATOM 76 N N . GLU 21 21 ? A 23.645 -22.080 32.275 1 1 C GLU 0.610 1
ATOM 77 C CA . GLU 21 21 ? A 24.010 -23.483 32.349 1 1 C GLU 0.610 1
ATOM 78 C C . GLU 21 21 ? A 25.283 -23.797 31.555 1 1 C GLU 0.610 1
ATOM 79 O O . GLU 21 21 ? A 25.509 -23.277 30.462 1 1 C GLU 0.610 1
ATOM 80 C CB . GLU 21 21 ? A 22.828 -24.366 31.893 1 1 C GLU 0.610 1
ATOM 81 C CG . GLU 21 21 ? A 22.978 -25.863 32.258 1 1 C GLU 0.610 1
ATOM 82 C CD . GLU 21 21 ? A 21.675 -26.649 32.079 1 1 C GLU 0.610 1
ATOM 83 O OE1 . GLU 21 21 ? A 20.706 -26.088 31.506 1 1 C GLU 0.610 1
ATOM 84 O OE2 . GLU 21 21 ? A 21.646 -27.819 32.539 1 1 C GLU 0.610 1
ATOM 85 N N . ALA 22 22 ? A 26.192 -24.625 32.120 1 1 C ALA 0.490 1
ATOM 86 C CA . ALA 22 22 ? A 27.447 -24.968 31.483 1 1 C ALA 0.490 1
ATOM 87 C C . ALA 22 22 ? A 27.269 -25.742 30.179 1 1 C ALA 0.490 1
ATOM 88 O O . ALA 22 22 ? A 26.425 -26.627 30.057 1 1 C ALA 0.490 1
ATOM 89 C CB . ALA 22 22 ? A 28.379 -25.726 32.452 1 1 C ALA 0.490 1
ATOM 90 N N . ILE 23 23 ? A 28.083 -25.420 29.160 1 1 C ILE 0.600 1
ATOM 91 C CA . ILE 23 23 ? A 27.934 -25.977 27.833 1 1 C ILE 0.600 1
ATOM 92 C C . ILE 23 23 ? A 29.041 -27.027 27.662 1 1 C ILE 0.600 1
ATOM 93 O O . ILE 23 23 ? A 30.200 -26.711 27.850 1 1 C ILE 0.600 1
ATOM 94 C CB . ILE 23 23 ? A 27.889 -24.880 26.757 1 1 C ILE 0.600 1
ATOM 95 C CG1 . ILE 23 23 ? A 29.106 -23.915 26.783 1 1 C ILE 0.600 1
ATOM 96 C CG2 . ILE 23 23 ? A 26.529 -24.168 26.976 1 1 C ILE 0.600 1
ATOM 97 C CD1 . ILE 23 23 ? A 28.964 -22.688 25.870 1 1 C ILE 0.600 1
ATOM 98 N N . PRO 24 24 ? A 28.720 -28.308 27.392 1 1 C PRO 0.700 1
ATOM 99 C CA . PRO 24 24 ? A 29.736 -29.329 27.136 1 1 C PRO 0.700 1
ATOM 100 C C . PRO 24 24 ? A 30.180 -29.291 25.681 1 1 C PRO 0.700 1
ATOM 101 O O . PRO 24 24 ? A 29.654 -28.503 24.880 1 1 C PRO 0.700 1
ATOM 102 C CB . PRO 24 24 ? A 28.982 -30.643 27.426 1 1 C PRO 0.700 1
ATOM 103 C CG . PRO 24 24 ? A 27.539 -30.326 27.031 1 1 C PRO 0.700 1
ATOM 104 C CD . PRO 24 24 ? A 27.369 -28.878 27.475 1 1 C PRO 0.700 1
ATOM 105 N N . GLU 25 25 ? A 31.136 -30.148 25.300 1 1 C GLU 0.690 1
ATOM 106 C CA . GLU 25 25 ? A 31.666 -30.246 23.955 1 1 C GLU 0.690 1
ATOM 107 C C . GLU 25 25 ? A 31.004 -31.425 23.247 1 1 C GLU 0.690 1
ATOM 108 O O . GLU 25 25 ? A 31.593 -32.490 23.042 1 1 C GLU 0.690 1
ATOM 109 C CB . GLU 25 25 ? A 33.210 -30.374 23.993 1 1 C GLU 0.690 1
ATOM 110 C CG . GLU 25 25 ? A 33.904 -29.154 24.655 1 1 C GLU 0.690 1
ATOM 111 C CD . GLU 25 25 ? A 35.425 -29.298 24.720 1 1 C GLU 0.690 1
ATOM 112 O OE1 . GLU 25 25 ? A 35.906 -30.439 24.946 1 1 C GLU 0.690 1
ATOM 113 O OE2 . GLU 25 25 ? A 36.113 -28.260 24.553 1 1 C GLU 0.690 1
ATOM 114 N N . GLU 26 26 ? A 29.718 -31.265 22.886 1 1 C GLU 0.700 1
ATOM 115 C CA . GLU 26 26 ? A 28.911 -32.275 22.226 1 1 C GLU 0.700 1
ATOM 116 C C . GLU 26 26 ? A 28.767 -31.934 20.756 1 1 C GLU 0.700 1
ATOM 117 O O . GLU 26 26 ? A 28.799 -30.771 20.348 1 1 C GLU 0.700 1
ATOM 118 C CB . GLU 26 26 ? A 27.504 -32.400 22.862 1 1 C GLU 0.700 1
ATOM 119 C CG . GLU 26 26 ? A 27.552 -32.972 24.300 1 1 C GLU 0.700 1
ATOM 120 C CD . GLU 26 26 ? A 26.196 -32.967 25.013 1 1 C GLU 0.700 1
ATOM 121 O OE1 . GLU 26 26 ? A 26.199 -33.300 26.227 1 1 C GLU 0.700 1
ATOM 122 O OE2 . GLU 26 26 ? A 25.173 -32.621 24.379 1 1 C GLU 0.700 1
ATOM 123 N N . TYR 27 27 ? A 28.622 -32.967 19.913 1 1 C TYR 0.470 1
ATOM 124 C CA . TYR 27 27 ? A 28.523 -32.826 18.468 1 1 C TYR 0.470 1
ATOM 125 C C . TYR 27 27 ? A 27.452 -33.793 17.992 1 1 C TYR 0.470 1
ATOM 126 O O . TYR 27 27 ? A 27.598 -34.469 16.967 1 1 C TYR 0.470 1
ATOM 127 C CB . TYR 27 27 ? A 29.861 -33.164 17.744 1 1 C TYR 0.470 1
ATOM 128 C CG . TYR 27 27 ? A 31.005 -32.320 18.252 1 1 C TYR 0.470 1
ATOM 129 C CD1 . TYR 27 27 ? A 31.178 -31.001 17.792 1 1 C TYR 0.470 1
ATOM 130 C CD2 . TYR 27 27 ? A 31.907 -32.836 19.204 1 1 C TYR 0.470 1
ATOM 131 C CE1 . TYR 27 27 ? A 32.242 -30.216 18.267 1 1 C TYR 0.470 1
ATOM 132 C CE2 . TYR 27 27 ? A 32.960 -32.046 19.697 1 1 C TYR 0.470 1
ATOM 133 C CZ . TYR 27 27 ? A 33.126 -30.739 19.214 1 1 C TYR 0.470 1
ATOM 134 O OH . TYR 27 27 ? A 34.182 -29.927 19.690 1 1 C TYR 0.470 1
ATOM 135 N N . LEU 28 28 ? A 26.364 -33.910 18.756 1 1 C LEU 0.480 1
ATOM 136 C CA . LEU 28 28 ? A 25.244 -34.784 18.518 1 1 C LEU 0.480 1
ATOM 137 C C . LEU 28 28 ? A 24.008 -33.893 18.862 1 1 C LEU 0.480 1
ATOM 138 O O . LEU 28 28 ? A 24.232 -32.825 19.528 1 1 C LEU 0.480 1
ATOM 139 C CB . LEU 28 28 ? A 25.422 -36.069 19.398 1 1 C LEU 0.480 1
ATOM 140 C CG . LEU 28 28 ? A 24.391 -37.229 19.346 1 1 C LEU 0.480 1
ATOM 141 C CD1 . LEU 28 28 ? A 23.300 -37.063 20.414 1 1 C LEU 0.480 1
ATOM 142 C CD2 . LEU 28 28 ? A 23.795 -37.494 17.955 1 1 C LEU 0.480 1
ATOM 143 O OXT . LEU 28 28 ? A 22.883 -34.223 18.431 1 1 C LEU 0.480 1
#
#
loop_
_atom_type.symbol
C
N
O
#
#
loop_
_ma_qa_metric.id
_ma_qa_metric.name
_ma_qa_metric.description
_ma_qa_metric.type
_ma_qa_metric.mode
_ma_qa_metric.type_other_details
_ma_qa_metric.software_group_id
1 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].'
'pLDDT all-atom in [0,1]' local . 5
2 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].'
'pLDDT all-atom in [0,1]' global . 5
3 GMQE
'Global Model Quality Estimate of the model accuracy, calculated by SWISS-MODEL.'
'normalized score' global . 6
#
#
loop_
_ma_qa_metric_global.ordinal_id
_ma_qa_metric_global.model_id
_ma_qa_metric_global.metric_id
_ma_qa_metric_global.metric_value
1 1 2 0.551
2 1 3 0.365
#
#
loop_
_ma_qa_metric_local.ordinal_id
_ma_qa_metric_local.model_id
_ma_qa_metric_local.label_asym_id
_ma_qa_metric_local.label_seq_id
_ma_qa_metric_local.label_comp_id
_ma_qa_metric_local.metric_id
_ma_qa_metric_local.metric_value
1 1 A 12 HIS 1 0.450
2 1 A 13 LYS 1 0.460
3 1 A 14 THR 1 0.600
4 1 A 15 ALA 1 0.490
5 1 A 16 PRO 1 0.490
6 1 A 17 PRO 1 0.660
7 1 A 18 PHE 1 0.520
8 1 A 19 ASP 1 0.490
9 1 A 20 PHE 1 0.460
10 1 A 21 GLU 1 0.610
11 1 A 22 ALA 1 0.490
12 1 A 23 ILE 1 0.600
13 1 A 24 PRO 1 0.700
14 1 A 25 GLU 1 0.690
15 1 A 26 GLU 1 0.700
16 1 A 27 TYR 1 0.470
17 1 A 28 LEU 1 0.480
#
#
loop_
_pdbx_data_usage.id
_pdbx_data_usage.type
_pdbx_data_usage.details
_pdbx_data_usage.url
1 license
;This SWISS-MODEL protein model is copyright.
It is produced by the SWISS-MODEL server, developed by the Computational
Structural Biology Group at the SIB Swiss Institute of Bioinformatics at the
Biozentrum, University of Basel (https://swissmodel.expasy.org). This
model is licensed under the CC BY-SA 4.0 Creative Commons
Attribution-ShareAlike 4.0 International License
(https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
can copy and redistribute the model in any medium or format,
transform and build upon the model for any purpose, even
commercially, under the following terms:
Attribution - You must give appropriate credit, provide a link to
the license, and indicate if changes were made. You may do so in any
reasonable manner, but not in any way that suggests the licensor
endorses you or your use. When you publish, patent or distribute
results that were fully or partially based on the model, please cite
the corresponding papers mentioned under JRNL.
ShareAlike - If you remix, transform, or build upon the material,
you must distribute your contributions under the same license as the
original.
No additional restrictions - you may not apply legal terms or
technological measures that legally restrict others from doing
anything the license permits.
Find a human-readable summary of (and not a substitute for) the
CC BY-SA 4.0 license at this link:
https://creativecommons.org/licenses/by-sa/4.0/
;
https://creativecommons.org/licenses/by-sa/4.0/legalcode
2 disclaimer
;The SWISS-MODEL SERVER produces theoretical models for
proteins. The results of any theoretical modelling procedure is
NON-EXPERIMENTAL and MUST be considered with care. These models may
contain significant errors. This is especially true for automated
modeling since there is no human intervention during model
building. Please read the header section and the logfile carefully
to know what templates and alignments were used during the model
building process. All information by the SWISS-MODEL SERVER is
provided "AS-IS", without any warranty, expressed or implied.
;
https://swissmodel.expasy.org/docs/terms_of_use#disclaimer
#