data_SMR-60dd435c675e6cca26fdf3bf04571745_1
_entry.id SMR-60dd435c675e6cca26fdf3bf04571745_1
_struct.entry_id SMR-60dd435c675e6cca26fdf3bf04571745_1
_struct.pdbx_model_details
;This model was generated unsupervised by the SWISS-MODEL homology-modelling pipeline for the SWISS-MODEL Repository, a database of annotated 3D protein structure models. The modelled monomer covers following UniProtKB entries:

  - P84648/ HYFLB_HYBFL, Cyclotide Hyfl-B

Estimated model accuracy of this model is 0.496, calculated by SWISS-MODEL as Global Model Quality Estimate (GMQE).
;
_struct.pdbx_structure_determination_methodology computational
_struct.title 'Model for UniProtKB entries P84648'
_audit_conform.dict_location https://raw.githubusercontent.com/ihmwg/ModelCIF/80e1e22/dist/mmcif_ma.dic
_audit_conform.dict_name mmcif_ma.dic
_audit_conform.dict_version 1.4.7
#
loop_
_citation.id
_citation.title
_citation.journal_abbrev
_citation.journal_volume
_citation.page_first
_citation.page_last
_citation.year
_citation.pdbx_database_id_PubMed
_citation.pdbx_database_id_DOI
primary 'The SWISS-MODEL Repository - new features and functionality'
'Nucleic Acids Res.' 45 D313 D319 2017 27899672 10.1093/nar/gkw1132
2 'SWISS-MODEL: homology modelling of protein structures and complexes'
'Nucleic Acids Res.' 46 W296 W303 2018 29788355 10.1093/nar/gky427
3 'ProMod3 - A versatile homology modelling toolbox' 'PLoS Comput. Biol.' 17(1)
1 18 2021 33507980 10.1371/journal.pcbi.1008667
4 'QMEANDisCo - distance constraints applied on model quality estimation'
Bioinformatics 36 1765 1771 2020 31697312 10.1093/bioinformatics/btz828
5
'OpenStructure: an integrated software framework for computational structural biology'
'Acta Crystallogr., Sect. D: Biol. Crystallogr.' 69 701 709 2013 23633579
10.1107/S0907444913007051
6 'BLAST+: architecture and applications' 'BMC Bioinf.' 10 421 . 2009 20003500
10.1186/1471-2105-10-421
7 'HH-suite3 for fast remote homology detection and deep protein annotation'
'BMC Bioinf.' 20 473 . 2019 31521110 10.1186/s12859-019-3019-7
#
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
primary 'Bienert, S.' 1
primary 'Waterhouse, A.' 2
primary 'de Beer, T.A.P.' 3
primary 'Tauriello, G.' 4
primary 'Studer, G.' 5
primary 'Bordoli, L.' 6
primary 'Schwede, T.' 7
2 'Waterhouse, A.' 8
2 'Bertoni, M.' 9
2 'Bienert, S.' 10
2 'Studer, G.' 11
2 'Tauriello, G.' 12
2 'Gumienny, R.' 13
2 'Heer, F.T.' 14
2 'de Beer, T.A.P.' 15
2 'Rempfer, C.' 16
2 'Bordoli, L.' 17
2 'Lepore, R.' 18
2 'Schwede, T.' 19
3 'Studer, G.' 20
3 'Tauriello, G.' 21
3 'Bienert, S.' 22
3 'Biasini, M.' 23
3 'Johner, N.' 24
3 'Schwede, T.' 25
4 'Studer, G.' 26
4 'Rempfer, C.' 27
4 'Waterhouse, A.M.' 28
4 'Gumienny, R.' 29
4 'Haas, J.' 30
4 'Schwede, T.' 31
5 'Biasini, M.' 32
5 'Schmidt, T.' 33
5 'Bienert, S.' 34
5 'Mariani, V.' 35
5 'Studer, G.' 36
5 'Haas, J.' 37
5 'Johner, N.' 38
5 'Schenk, A.D.' 39
5 'Philippsen, A.' 40
5 'Schwede, T.' 41
6 'Camacho, C.' 42
6 'Coulouris, G.' 43
6 'Avagyan, V.' 44
6 'Ma, N.' 45
6 'Papadopoulos, J.' 46
6 'Bealer, K.' 47
6 'Madden, T.L.' 48
7 'Steinegger, M.' 49
7 'Meier, M.' 50
7 'Mirdita, M.' 51
7 'Vohringer, H.' 52
7 'Haunsberger, S.J.' 53
7 'Soding, J.' 54
#
#
loop_
_software.pdbx_ordinal
_software.name
_software.classification
_software.description
_software.version
_software.type
_software.location
_software.citation_id
1 SWISS-MODEL 'model building' 'Homology modelling web service' 2025-06.3
package https://swissmodel.expasy.org 2
2 ProMod3 'model building' 'Modular homology modelling engine' 3.5.0 library
https://git.scicore.unibas.ch/schwede/ProMod3 3
3 QMEAN 'model building' 'QMEAN - Qualitative Model Energy ANalysis' 4.4.0
library https://git.scicore.unibas.ch/schwede/QMEAN 4
4 OpenStructure 'data processing'
'Open-Source Computational Structural Biology Framework' 2.10.0 package
https://openstructure.org/ 5
5 BLAST 'data collection' . 2.14.1 package https://blast.ncbi.nlm.nih.gov 6
6 HH-suite 'data collection' 'HH-suite3 for sensitive sequence searching' 3.2.0
package https://github.com/soedinglab/hh-suite 7
#
#
loop_
_ma_software_group.ordinal_id
_ma_software_group.group_id
_ma_software_group.software_id
_ma_software_group.parameter_group_id
1 1 6 .
2 2 1 .
3 2 4 .
4 2 5 .
5 2 6 .
6 3 1 .
7 3 4 .
8 4 1 .
9 4 2 .
10 4 4 .
11 5 3 .
12 6 1 .
13 6 3 .
14 6 4 .
#
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
'Bienert, S.' 1
'Waterhouse, A.' 2
'de Beer, T.A.P.' 3
'Tauriello, G.' 4
'Studer, G.' 5
'Bordoli, L.' 6
'Schwede, T.' 7
#
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.name
_chem_comp.formula
_chem_comp.formula_weight
_chem_comp.ma_provenance
ALA 'L-peptide linking' ALANINE 'C3 H7 N O2' 89.094 'CCD Core'
ASN 'L-peptide linking' ASPARAGINE 'C4 H8 N2 O3' 132.119 'CCD Core'
CYS 'L-peptide linking' CYSTEINE 'C3 H7 N O2 S' 121.154 'CCD Core'
GLN 'L-peptide linking' GLUTAMINE 'C5 H10 N2 O3' 146.146 'CCD Core'
GLU 'L-peptide linking' 'GLUTAMIC ACID' 'C5 H9 N O4' 147.130 'CCD Core'
GLY 'peptide linking' GLYCINE 'C2 H5 N O2' 75.067 'CCD Core'
ILE 'L-peptide linking' ISOLEUCINE 'C6 H13 N O2' 131.175 'CCD Core'
LEU 'L-peptide linking' LEUCINE 'C6 H13 N O2' 131.175 'CCD Core'
LYS 'L-peptide linking' LYSINE 'C6 H15 N2 O2 1' 147.198 'CCD Core'
MET 'L-peptide linking' METHIONINE 'C5 H11 N O2 S' 149.208 'CCD Core'
PHE 'L-peptide linking' PHENYLALANINE 'C9 H11 N O2' 165.192 'CCD Core'
PRO 'L-peptide linking' PROLINE 'C5 H9 N O2' 115.132 'CCD Core'
SER 'L-peptide linking' SERINE 'C3 H7 N O3' 105.093 'CCD Core'
THR 'L-peptide linking' THREONINE 'C4 H9 N O3' 119.120 'CCD Core'
TYR 'L-peptide linking' TYROSINE 'C9 H11 N O3' 181.191 'CCD Core'
VAL 'L-peptide linking' VALINE 'C5 H11 N O2' 117.148 'CCD Core'
#
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.details
1 polymer man . 4026.552 1 .
#
#
loop_
_struct_ref.id
_struct_ref.entity_id
_struct_ref.db_name
_struct_ref.db_code
_struct_ref.pdbx_db_accession
_struct_ref.pdbx_align_begin
_struct_ref.pdbx_seq_one_letter_code
_struct_ref.details
1 1 UNP HYFLB_HYBFL P84648 1 GSPIQCAETCFIGKCYTEELGCTCTAFLCMKN 'Cyclotide Hyfl-B'
#
#
loop_
_struct_ref_seq.align_id
_struct_ref_seq.ref_id
_struct_ref_seq.seq_align_beg
_struct_ref_seq.seq_align_end
_struct_ref_seq.db_align_beg
_struct_ref_seq.db_align_end
1 1 1 32 1 32
#
#
loop_
_ma_target_ref_db_details.target_entity_id
_ma_target_ref_db_details.db_name
_ma_target_ref_db_details.db_name_other_details
_ma_target_ref_db_details.db_code
_ma_target_ref_db_details.db_accession
_ma_target_ref_db_details.seq_db_isoform
_ma_target_ref_db_details.seq_db_align_begin
_ma_target_ref_db_details.seq_db_align_end
_ma_target_ref_db_details.ncbi_taxonomy_id
_ma_target_ref_db_details.organism_scientific
_ma_target_ref_db_details.seq_db_sequence_version_date
_ma_target_ref_db_details.seq_db_sequence_checksum
_ma_target_ref_db_details.is_primary
1 UNP . HYFLB_HYBFL P84648 . 1 32 343459 'Hybanthus floribundus (Greenviolet)'
2005-11-22 786F0DFEEC7E804B .
#
#
loop_
_entity_poly.entity_id
_entity_poly.type
_entity_poly.nstd_linkage
_entity_poly.nstd_monomer
_entity_poly.pdbx_strand_id
_entity_poly.pdbx_seq_one_letter_code
_entity_poly.pdbx_seq_one_letter_code_can
1 polypeptide(L) no no B GSPIQCAETCFIGKCYTEELGCTCTAFLCMKN
GSPIQCAETCFIGKCYTEELGCTCTAFLCMKN
#
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 GLY .
1 2 SER .
1 3 PRO .
1 4 ILE .
1 5 GLN .
1 6 CYS .
1 7 ALA .
1 8 GLU .
1 9 THR .
1 10 CYS .
1 11 PHE .
1 12 ILE .
1 13 GLY .
1 14 LYS .
1 15 CYS .
1 16 TYR .
1 17 THR .
1 18 GLU .
1 19 GLU .
1 20 LEU .
1 21 GLY .
1 22 CYS .
1 23 THR .
1 24 CYS .
1 25 THR .
1 26 ALA .
1 27 PHE .
1 28 LEU .
1 29 CYS .
1 30 MET .
1 31 LYS .
1 32 ASN .
#
#
loop_
_struct_asym.id
_struct_asym.entity_id
_struct_asym.details
A 1 .
#
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
A 1 1 GLY 1 ? ? ? B .
A 1 2 SER 2 ? ? ? B .
A 1 3 PRO 3 3 PRO PRO B .
A 1 4 ILE 4 4 ILE ILE B .
A 1 5 GLN 5 5 GLN GLN B .
A 1 6 CYS 6 6 CYS CYS B .
A 1 7 ALA 7 7 ALA ALA B .
A 1 8 GLU 8 8 GLU GLU B .
A 1 9 THR 9 9 THR THR B .
A 1 10 CYS 10 10 CYS CYS B .
A 1 11 PHE 11 11 PHE PHE B .
A 1 12 ILE 12 12 ILE ILE B .
A 1 13 GLY 13 13 GLY GLY B .
A 1 14 LYS 14 14 LYS LYS B .
A 1 15 CYS 15 15 CYS CYS B .
A 1 16 TYR 16 16 TYR TYR B .
A 1 17 THR 17 17 THR THR B .
A 1 18 GLU 18 18 GLU GLU B .
A 1 19 GLU 19 19 GLU GLU B .
A 1 20 LEU 20 20 LEU LEU B .
A 1 21 GLY 21 21 GLY GLY B .
A 1 22 CYS 22 22 CYS CYS B .
A 1 23 THR 23 23 THR THR B .
A 1 24 CYS 24 24 CYS CYS B .
A 1 25 THR 25 25 THR THR B .
A 1 26 ALA 26 26 ALA ALA B .
A 1 27 PHE 27 27 PHE PHE B .
A 1 28 LEU 28 28 LEU LEU B .
A 1 29 CYS 29 29 CYS CYS B .
A 1 30 MET 30 30 MET MET B .
A 1 31 LYS 31 31 LYS LYS B .
A 1 32 ASN 32 32 ASN ASN B .
#
#
loop_
_ma_data.id
_ma_data.name
_ma_data.content_type
_ma_data.content_type_other_details
1
'Cyclotide hyen-D {PDB ID=7rih, label_asym_id=B, auth_asym_id=B, SMTL ID=7rih.1.B}'
'template structure' .
2 . target .
3 'Target-template alignment by HHblits to 7rih, label_asym_id=B'
'target-template alignment' .
4 'model 1' 'model coordinates' .
5 SMTL 'reference database' .
6 PDB 'reference database' .
7 'Template search output' other 'Results of the sequence search'
#
#
loop_
_ma_data_group.ordinal_id
_ma_data_group.group_id
_ma_data_group.data_id
1 1 2
2 1 5
3 1 6
4 2 7
5 3 2
6 3 1
7 3 3
8 4 1
9 4 3
10 5 4
#
#
loop_
_ma_data_ref_db.data_id
_ma_data_ref_db.name
_ma_data_ref_db.location_url
_ma_data_ref_db.version
_ma_data_ref_db.release_date
5 SMTL https://swissmodel.expasy.org/templates/ . 2025-06-25
6 PDB https://www.wwpdb.org . 2025-06-20
#
#
loop_
_ma_target_entity.entity_id
_ma_target_entity.data_id
_ma_target_entity.origin
1 2 'reference database'
#
#
loop_
_ma_target_entity_instance.asym_id
_ma_target_entity_instance.entity_id
_ma_target_entity_instance.details
A 1 .
#
#
loop_
_ma_template_trans_matrix.id
_ma_template_trans_matrix.rot_matrix[1][1]
_ma_template_trans_matrix.rot_matrix[2][1]
_ma_template_trans_matrix.rot_matrix[3][1]
_ma_template_trans_matrix.rot_matrix[1][2]
_ma_template_trans_matrix.rot_matrix[2][2]
_ma_template_trans_matrix.rot_matrix[3][2]
_ma_template_trans_matrix.rot_matrix[1][3]
_ma_template_trans_matrix.rot_matrix[2][3]
_ma_template_trans_matrix.rot_matrix[3][3]
_ma_template_trans_matrix.tr_vector[1]
_ma_template_trans_matrix.tr_vector[2]
_ma_template_trans_matrix.tr_vector[3]
1 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000
1.000000 0 0 0
#
#
loop_
_ma_template_details.ordinal_id
_ma_template_details.template_id
_ma_template_details.template_origin
_ma_template_details.template_entity_type
_ma_template_details.template_trans_matrix_id
_ma_template_details.template_data_id
_ma_template_details.target_asym_id
_ma_template_details.template_label_asym_id
_ma_template_details.template_label_entity_id
_ma_template_details.template_model_num
_ma_template_details.template_auth_asym_id
1 1 'reference database' polymer 1 1 A B 2 1 B
#
#
loop_
_ma_template_poly.template_id
_ma_template_poly.seq_one_letter_code
_ma_template_poly.seq_one_letter_code_can
1 GFPCGESCVYIPCFTAAIGCSCKSKVCYKN GFPCGESCVYIPCFTAAIGCSCKSKVCYKN
#
#
loop_
_ma_template_poly_segment.id
_ma_template_poly_segment.template_id
_ma_template_poly_segment.residue_number_begin
_ma_template_poly_segment.residue_number_end
1 1 1 30
#
#
loop_
_ma_template_ref_db_details.template_id
_ma_template_ref_db_details.db_name
_ma_template_ref_db_details.db_name_other_details
_ma_template_ref_db_details.db_accession_code
_ma_template_ref_db_details.db_version_date
1 PDB . 7rih 2024-10-09
#
#
loop_
_ma_target_template_poly_mapping.id
_ma_target_template_poly_mapping.template_segment_id
_ma_target_template_poly_mapping.target_asym_id
_ma_target_template_poly_mapping.target_seq_id_begin
_ma_target_template_poly_mapping.target_seq_id_end
1 1 A 1 32
#
#
loop_
_ma_alignment_info.alignment_id
_ma_alignment_info.data_id
_ma_alignment_info.software_group_id
_ma_alignment_info.alignment_length
_ma_alignment_info.alignment_type
_ma_alignment_info.alignment_mode
1 3 1 32 'target-template pairwise alignment' local
#
#
loop_
_ma_alignment_details.ordinal_id
_ma_alignment_details.alignment_id
_ma_alignment_details.template_segment_id
_ma_alignment_details.target_asym_id
_ma_alignment_details.score_type
_ma_alignment_details.score_type_other_details
_ma_alignment_details.score_value
_ma_alignment_details.percent_sequence_identity
_ma_alignment_details.sequence_identity_denominator
_ma_alignment_details.sequence_identity_denominator_other_details
1 1 1 A 'HHblits e-value' . 1e-18 36.667
'Number of aligned residue pairs (not including the gaps)' .
#
#
loop_
_ma_alignment.ordinal_id
_ma_alignment.alignment_id
_ma_alignment.target_template_flag
_ma_alignment.sequence
1 1 1 GSPIQCAETCFIGKCYTEELGCTCTAFLCMKN
2 1 2 --GFPCGESCVYIPCFTAAIGCSCKSKVCYKN
#
#
loop_
_ma_protocol_step.ordinal_id
_ma_protocol_step.protocol_id
_ma_protocol_step.step_id
_ma_protocol_step.method_type
_ma_protocol_step.step_name
_ma_protocol_step.details
_ma_protocol_step.software_group_id
_ma_protocol_step.input_data_group_id
_ma_protocol_step.output_data_group_id
1 1 1 'template search' 'template search' 'SWISS-MODEL template search in PDB' 2
1 2
2 1 2 'template selection' 'template selection'
'Automatic template selection by SWISS-MODEL {QSQE=0.000}' 3 2 4
3 1 3 modeling 'homology modeling'
'SWISS-MODEL auto-model mode using ProMod3 on 7rih.1' 4 3 5
#
#
loop_
_ma_model_list.ordinal_id
_ma_model_list.model_name
_ma_model_list.data_id
_ma_model_list.model_type
_ma_model_list.model_type_other_details
1 'model 1' 4 'Homology model' .
#
#
loop_
_ma_model_group.id
_ma_model_group.name
_ma_model_group.details
1 . .
#
#
loop_
_ma_model_group_link.group_id
_ma_model_group_link.model_id
1 1
#
#
loop_
_atom_site.group_PDB
_atom_site.id
_atom_site.type_symbol
_atom_site.label_atom_id
_atom_site.label_alt_id
_atom_site.label_comp_id
_atom_site.label_seq_id
_atom_site.auth_seq_id
_atom_site.pdbx_PDB_ins_code
_atom_site.label_asym_id
_atom_site.Cartn_x
_atom_site.Cartn_y
_atom_site.Cartn_z
_atom_site.occupancy
_atom_site.label_entity_id
_atom_site.auth_asym_id
_atom_site.auth_comp_id
_atom_site.B_iso_or_equiv
_atom_site.pdbx_PDB_model_num
ATOM 1 N N . PRO 3 3 ? A -9.871 11.268 -6.862 1 1 B PRO 0.450 1
ATOM 2 C CA . PRO 3 3 ? A -9.215 11.878 -8.081 1 1 B PRO 0.450 1
ATOM 3 C C . PRO 3 3 ? A -8.960 10.957 -9.348 1 1 B PRO 0.450 1
ATOM 4 O O . PRO 3 3 ? A -8.917 11.541 -10.380 1 1 B PRO 0.450 1
ATOM 5 C CB . PRO 3 3 ? A -7.952 12.492 -7.447 1 1 B PRO 0.450 1
ATOM 6 C CG . PRO 3 3 ? A -8.298 12.988 -6.047 1 1 B PRO 0.450 1
ATOM 7 C CD . PRO 3 3 ? A -9.548 12.122 -5.646 1 1 B PRO 0.450 1
ATOM 8 N N . ILE 4 4 ? A -8.846 9.580 -9.286 1 1 B ILE 0.490 1
ATOM 9 C CA . ILE 4 4 ? A -8.472 8.604 -10.326 1 1 B ILE 0.490 1
ATOM 10 C C . ILE 4 4 ? A -9.704 7.923 -10.827 1 1 B ILE 0.490 1
ATOM 11 O O . ILE 4 4 ? A -10.538 7.450 -10.056 1 1 B ILE 0.490 1
ATOM 12 C CB . ILE 4 4 ? A -7.503 7.466 -9.904 1 1 B ILE 0.490 1
ATOM 13 C CG1 . ILE 4 4 ? A -6.185 8.026 -9.319 1 1 B ILE 0.490 1
ATOM 14 C CG2 . ILE 4 4 ? A -7.186 6.451 -11.053 1 1 B ILE 0.490 1
ATOM 15 C CD1 . ILE 4 4 ? A -5.274 6.965 -8.670 1 1 B ILE 0.490 1
ATOM 16 N N . GLN 5 5 ? A -9.849 7.884 -12.168 1 1 B GLN 0.490 1
ATOM 17 C CA . GLN 5 5 ? A -10.921 7.245 -12.878 1 1 B GLN 0.490 1
ATOM 18 C C . GLN 5 5 ? A -10.910 5.730 -12.793 1 1 B GLN 0.490 1
ATOM 19 O O . GLN 5 5 ? A -9.885 5.095 -13.010 1 1 B GLN 0.490 1
ATOM 20 C CB . GLN 5 5 ? A -10.849 7.699 -14.362 1 1 B GLN 0.490 1
ATOM 21 C CG . GLN 5 5 ? A -10.914 9.239 -14.504 1 1 B GLN 0.490 1
ATOM 22 C CD . GLN 5 5 ? A -12.261 9.711 -13.970 1 1 B GLN 0.490 1
ATOM 23 O OE1 . GLN 5 5 ? A -13.214 8.926 -13.918 1 1 B GLN 0.490 1
ATOM 24 N NE2 . GLN 5 5 ? A -12.391 10.979 -13.546 1 1 B GLN 0.490 1
ATOM 25 N N . CYS 6 6 ? A -12.071 5.105 -12.521 1 1 B CYS 0.630 1
ATOM 26 C CA . CYS 6 6 ? A -12.170 3.665 -12.318 1 1 B CYS 0.630 1
ATOM 27 C C . CYS 6 6 ? A -12.641 2.902 -13.545 1 1 B CYS 0.630 1
ATOM 28 O O . CYS 6 6 ? A -13.057 1.749 -13.452 1 1 B CYS 0.630 1
ATOM 29 C CB . CYS 6 6 ? A -13.140 3.310 -11.181 1 1 B CYS 0.630 1
ATOM 30 S SG . CYS 6 6 ? A -12.659 4.030 -9.602 1 1 B CYS 0.630 1
ATOM 31 N N . ALA 7 7 ? A -12.624 3.559 -14.715 1 1 B ALA 0.600 1
ATOM 32 C CA . ALA 7 7 ? A -12.921 2.962 -16.003 1 1 B ALA 0.600 1
ATOM 33 C C . ALA 7 7 ? A -14.412 2.744 -16.249 1 1 B ALA 0.600 1
ATOM 34 O O . ALA 7 7 ? A -14.815 1.831 -16.966 1 1 B ALA 0.600 1
ATOM 35 C CB . ALA 7 7 ? A -12.048 1.718 -16.318 1 1 B ALA 0.600 1
ATOM 36 N N . GLU 8 8 ? A -15.273 3.624 -15.701 1 1 B GLU 0.560 1
ATOM 37 C CA . GLU 8 8 ? A -16.700 3.487 -15.850 1 1 B GLU 0.560 1
ATOM 38 C C . GLU 8 8 ? A -17.298 4.877 -15.798 1 1 B GLU 0.560 1
ATOM 39 O O . GLU 8 8 ? A -16.768 5.767 -15.124 1 1 B GLU 0.560 1
ATOM 40 C CB . GLU 8 8 ? A -17.274 2.555 -14.750 1 1 B GLU 0.560 1
ATOM 41 C CG . GLU 8 8 ? A -18.811 2.375 -14.761 1 1 B GLU 0.560 1
ATOM 42 C CD . GLU 8 8 ? A -19.335 1.530 -13.608 1 1 B GLU 0.560 1
ATOM 43 O OE1 . GLU 8 8 ? A -20.547 1.207 -13.627 1 1 B GLU 0.560 1
ATOM 44 O OE2 . GLU 8 8 ? A -18.564 1.219 -12.668 1 1 B GLU 0.560 1
ATOM 45 N N . THR 9 9 ? A -18.387 5.119 -16.553 1 1 B THR 0.600 1
ATOM 46 C CA . THR 9 9 ? A -19.123 6.374 -16.568 1 1 B THR 0.600 1
ATOM 47 C C . THR 9 9 ? A -20.431 6.186 -15.834 1 1 B THR 0.600 1
ATOM 48 O O . THR 9 9 ? A -20.899 5.068 -15.649 1 1 B THR 0.600 1
ATOM 49 C CB . THR 9 9 ? A -19.389 6.920 -17.973 1 1 B THR 0.600 1
ATOM 50 O OG1 . THR 9 9 ? A -20.167 6.050 -18.782 1 1 B THR 0.600 1
ATOM 51 C CG2 . THR 9 9 ? A -18.052 7.081 -18.707 1 1 B THR 0.600 1
ATOM 52 N N . CYS 10 10 ? A -21.073 7.269 -15.371 1 1 B CYS 0.620 1
ATOM 53 C CA . CYS 10 10 ? A -22.227 7.134 -14.503 1 1 B CYS 0.620 1
ATOM 54 C C . CYS 10 10 ? A -23.176 8.299 -14.719 1 1 B CYS 0.620 1
ATOM 55 O O . CYS 10 10 ? A -23.368 9.152 -13.860 1 1 B CYS 0.620 1
ATOM 56 C CB . CYS 10 10 ? A -21.804 7.003 -13.011 1 1 B CYS 0.620 1
ATOM 57 S SG . CYS 10 10 ? A -20.601 8.251 -12.463 1 1 B CYS 0.620 1
ATOM 58 N N . PHE 11 11 ? A -23.785 8.388 -15.924 1 1 B PHE 0.460 1
ATOM 59 C CA . PHE 11 11 ? A -24.748 9.436 -16.239 1 1 B PHE 0.460 1
ATOM 60 C C . PHE 11 11 ? A -26.145 9.165 -15.656 1 1 B PHE 0.460 1
ATOM 61 O O . PHE 11 11 ? A -26.661 9.955 -14.874 1 1 B PHE 0.460 1
ATOM 62 C CB . PHE 11 11 ? A -24.752 9.637 -17.792 1 1 B PHE 0.460 1
ATOM 63 C CG . PHE 11 11 ? A -25.677 10.728 -18.280 1 1 B PHE 0.460 1
ATOM 64 C CD1 . PHE 11 11 ? A -26.854 10.411 -18.972 1 1 B PHE 0.460 1
ATOM 65 C CD2 . PHE 11 11 ? A -25.402 12.078 -18.032 1 1 B PHE 0.460 1
ATOM 66 C CE1 . PHE 11 11 ? A -27.795 11.399 -19.284 1 1 B PHE 0.460 1
ATOM 67 C CE2 . PHE 11 11 ? A -26.323 13.077 -18.368 1 1 B PHE 0.460 1
ATOM 68 C CZ . PHE 11 11 ? A -27.531 12.735 -18.977 1 1 B PHE 0.460 1
ATOM 69 N N . ILE 12 12 ? A -26.757 8.004 -15.983 1 1 B ILE 0.300 1
ATOM 70 C CA . ILE 12 12 ? A -28.065 7.601 -15.473 1 1 B ILE 0.300 1
ATOM 71 C C . ILE 12 12 ? A -27.984 6.373 -14.590 1 1 B ILE 0.300 1
ATOM 72 O O . ILE 12 12 ? A -28.843 6.127 -13.745 1 1 B ILE 0.300 1
ATOM 73 C CB . ILE 12 12 ? A -29.027 7.271 -16.614 1 1 B ILE 0.300 1
ATOM 74 C CG1 . ILE 12 12 ? A -28.424 6.285 -17.653 1 1 B ILE 0.300 1
ATOM 75 C CG2 . ILE 12 12 ? A -29.465 8.611 -17.243 1 1 B ILE 0.300 1
ATOM 76 C CD1 . ILE 12 12 ? A -29.443 5.766 -18.674 1 1 B ILE 0.300 1
ATOM 77 N N . GLY 13 13 ? A -26.921 5.564 -14.750 1 1 B GLY 0.330 1
ATOM 78 C CA . GLY 13 13 ? A -26.722 4.353 -13.990 1 1 B GLY 0.330 1
ATOM 79 C C . GLY 13 13 ? A -25.580 4.608 -13.087 1 1 B GLY 0.330 1
ATOM 80 O O . GLY 13 13 ? A -24.617 5.264 -13.476 1 1 B GLY 0.330 1
ATOM 81 N N . LYS 14 14 ? A -25.691 4.107 -11.851 1 1 B LYS 0.570 1
ATOM 82 C CA . LYS 14 14 ? A -24.676 4.229 -10.828 1 1 B LYS 0.570 1
ATOM 83 C C . LYS 14 14 ? A -23.470 3.366 -11.111 1 1 B LYS 0.570 1
ATOM 84 O O . LYS 14 14 ? A -23.520 2.485 -11.961 1 1 B LYS 0.570 1
ATOM 85 C CB . LYS 14 14 ? A -25.228 3.870 -9.436 1 1 B LYS 0.570 1
ATOM 86 C CG . LYS 14 14 ? A -26.314 4.857 -9.014 1 1 B LYS 0.570 1
ATOM 87 C CD . LYS 14 14 ? A -26.888 4.505 -7.644 1 1 B LYS 0.570 1
ATOM 88 C CE . LYS 14 14 ? A -27.945 5.503 -7.186 1 1 B LYS 0.570 1
ATOM 89 N NZ . LYS 14 14 ? A -28.467 5.090 -5.870 1 1 B LYS 0.570 1
ATOM 90 N N . CYS 15 15 ? A -22.360 3.613 -10.396 1 1 B CYS 0.620 1
ATOM 91 C CA . CYS 15 15 ? A -21.117 2.909 -10.615 1 1 B CYS 0.620 1
ATOM 92 C C . CYS 15 15 ? A -21.180 1.483 -10.115 1 1 B CYS 0.620 1
ATOM 93 O O . CYS 15 15 ? A -21.294 1.239 -8.911 1 1 B CYS 0.620 1
ATOM 94 C CB . CYS 15 15 ? A -19.942 3.620 -9.891 1 1 B CYS 0.620 1
ATOM 95 S SG . CYS 15 15 ? A -19.683 5.314 -10.467 1 1 B CYS 0.620 1
ATOM 96 N N . TYR 16 16 ? A -21.027 0.489 -11.001 1 1 B TYR 0.440 1
ATOM 97 C CA . TYR 16 16 ? A -20.770 -0.892 -10.634 1 1 B TYR 0.440 1
ATOM 98 C C . TYR 16 16 ? A -19.441 -0.975 -9.892 1 1 B TYR 0.440 1
ATOM 99 O O . TYR 16 16 ? A -19.274 -1.725 -8.940 1 1 B TYR 0.440 1
ATOM 100 C CB . TYR 16 16 ? A -20.735 -1.811 -11.878 1 1 B TYR 0.440 1
ATOM 101 C CG . TYR 16 16 ? A -22.097 -1.990 -12.485 1 1 B TYR 0.440 1
ATOM 102 C CD1 . TYR 16 16 ? A -23.076 -2.745 -11.826 1 1 B TYR 0.440 1
ATOM 103 C CD2 . TYR 16 16 ? A -22.404 -1.445 -13.739 1 1 B TYR 0.440 1
ATOM 104 C CE1 . TYR 16 16 ? A -24.337 -2.944 -12.406 1 1 B TYR 0.440 1
ATOM 105 C CE2 . TYR 16 16 ? A -23.661 -1.644 -14.321 1 1 B TYR 0.440 1
ATOM 106 C CZ . TYR 16 16 ? A -24.628 -2.399 -13.656 1 1 B TYR 0.440 1
ATOM 107 O OH . TYR 16 16 ? A -25.884 -2.623 -14.250 1 1 B TYR 0.440 1
ATOM 108 N N . THR 17 17 ? A -18.458 -0.128 -10.268 1 1 B THR 0.620 1
ATOM 109 C CA . THR 17 17 ? A -17.201 0.023 -9.523 1 1 B THR 0.620 1
ATOM 110 C C . THR 17 17 ? A -17.280 0.521 -8.083 1 1 B THR 0.620 1
ATOM 111 O O . THR 17 17 ? A -16.243 0.580 -7.404 1 1 B THR 0.620 1
ATOM 112 C CB . THR 17 17 ? A -16.112 0.793 -10.240 1 1 B THR 0.620 1
ATOM 113 O OG1 . THR 17 17 ? A -16.482 2.132 -10.601 1 1 B THR 0.620 1
ATOM 114 C CG2 . THR 17 17 ? A -15.770 0.055 -11.536 1 1 B THR 0.620 1
ATOM 115 N N . GLU 18 18 ? A -18.479 0.772 -7.509 1 1 B GLU 0.590 1
ATOM 116 C CA . GLU 18 18 ? A -18.725 0.849 -6.070 1 1 B GLU 0.590 1
ATOM 117 C C . GLU 18 18 ? A -18.257 -0.423 -5.366 1 1 B GLU 0.590 1
ATOM 118 O O . GLU 18 18 ? A -17.758 -0.367 -4.246 1 1 B GLU 0.590 1
ATOM 119 C CB . GLU 18 18 ? A -20.217 1.102 -5.717 1 1 B GLU 0.590 1
ATOM 120 C CG . GLU 18 18 ? A -20.731 2.542 -6.004 1 1 B GLU 0.590 1
ATOM 121 C CD . GLU 18 18 ? A -22.227 2.777 -5.743 1 1 B GLU 0.590 1
ATOM 122 O OE1 . GLU 18 18 ? A -22.919 1.858 -5.235 1 1 B GLU 0.590 1
ATOM 123 O OE2 . GLU 18 18 ? A -22.699 3.903 -6.067 1 1 B GLU 0.590 1
ATOM 124 N N . GLU 19 19 ? A -18.303 -1.591 -6.064 1 1 B GLU 0.610 1
ATOM 125 C CA . GLU 19 19 ? A -17.735 -2.861 -5.626 1 1 B GLU 0.610 1
ATOM 126 C C . GLU 19 19 ? A -16.254 -2.788 -5.235 1 1 B GLU 0.610 1
ATOM 127 O O . GLU 19 19 ? A -15.798 -3.486 -4.333 1 1 B GLU 0.610 1
ATOM 128 C CB . GLU 19 19 ? A -17.938 -3.949 -6.710 1 1 B GLU 0.610 1
ATOM 129 C CG . GLU 19 19 ? A -19.421 -4.322 -6.969 1 1 B GLU 0.610 1
ATOM 130 C CD . GLU 19 19 ? A -19.578 -5.399 -8.044 1 1 B GLU 0.610 1
ATOM 131 O OE1 . GLU 19 19 ? A -18.550 -5.811 -8.641 1 1 B GLU 0.610 1
ATOM 132 O OE2 . GLU 19 19 ? A -20.743 -5.825 -8.259 1 1 B GLU 0.610 1
ATOM 133 N N . LEU 20 20 ? A -15.465 -1.898 -5.879 1 1 B LEU 0.490 1
ATOM 134 C CA . LEU 20 20 ? A -14.063 -1.692 -5.556 1 1 B LEU 0.490 1
ATOM 135 C C . LEU 20 20 ? A -13.834 -0.351 -4.880 1 1 B LEU 0.490 1
ATOM 136 O O . LEU 20 20 ? A -12.696 0.098 -4.689 1 1 B LEU 0.490 1
ATOM 137 C CB . LEU 20 20 ? A -13.169 -1.883 -6.805 1 1 B LEU 0.490 1
ATOM 138 C CG . LEU 20 20 ? A -13.193 -3.324 -7.369 1 1 B LEU 0.490 1
ATOM 139 C CD1 . LEU 20 20 ? A -12.353 -3.405 -8.654 1 1 B LEU 0.490 1
ATOM 140 C CD2 . LEU 20 20 ? A -12.711 -4.376 -6.350 1 1 B LEU 0.490 1
ATOM 141 N N . GLY 21 21 ? A -14.916 0.307 -4.424 1 1 B GLY 0.660 1
ATOM 142 C CA . GLY 21 21 ? A -14.860 1.543 -3.662 1 1 B GLY 0.660 1
ATOM 143 C C . GLY 21 21 ? A -14.849 2.810 -4.462 1 1 B GLY 0.660 1
ATOM 144 O O . GLY 21 21 ? A -14.405 3.836 -3.958 1 1 B GLY 0.660 1
ATOM 145 N N . CYS 22 22 ? A -15.307 2.783 -5.722 1 1 B CYS 0.680 1
ATOM 146 C CA . CYS 22 22 ? A -15.430 3.976 -6.537 1 1 B CYS 0.680 1
ATOM 147 C C . CYS 22 22 ? A -16.775 4.643 -6.342 1 1 B CYS 0.680 1
ATOM 148 O O . CYS 22 22 ? A -17.714 4.051 -5.819 1 1 B CYS 0.680 1
ATOM 149 C CB . CYS 22 22 ? A -15.217 3.678 -8.033 1 1 B CYS 0.680 1
ATOM 150 S SG . CYS 22 22 ? A -13.647 2.819 -8.322 1 1 B CYS 0.680 1
ATOM 151 N N . THR 23 23 ? A -16.899 5.916 -6.735 1 1 B THR 0.660 1
ATOM 152 C CA . THR 23 23 ? A -18.123 6.678 -6.578 1 1 B THR 0.660 1
ATOM 153 C C . THR 23 23 ? A -18.279 7.571 -7.775 1 1 B THR 0.660 1
ATOM 154 O O . THR 23 23 ? A -17.317 7.807 -8.504 1 1 B THR 0.660 1
ATOM 155 C CB . THR 23 23 ? A -18.136 7.503 -5.292 1 1 B THR 0.660 1
ATOM 156 O OG1 . THR 23 23 ? A -19.394 8.119 -5.057 1 1 B THR 0.660 1
ATOM 157 C CG2 . THR 23 23 ? A -17.059 8.606 -5.288 1 1 B THR 0.660 1
ATOM 158 N N . CYS 24 24 ? A -19.496 8.076 -8.027 1 1 B CYS 0.650 1
ATOM 159 C CA . CYS 24 24 ? A -19.792 8.919 -9.167 1 1 B CYS 0.650 1
ATOM 160 C C . CYS 24 24 ? A -19.502 10.384 -8.890 1 1 B CYS 0.650 1
ATOM 161 O O . CYS 24 24 ? A -20.104 10.992 -8.009 1 1 B CYS 0.650 1
ATOM 162 C CB . CYS 24 24 ? A -21.279 8.801 -9.589 1 1 B CYS 0.650 1
ATOM 163 S SG . CYS 24 24 ? A -21.610 9.503 -11.233 1 1 B CYS 0.650 1
ATOM 164 N N . THR 25 25 ? A -18.607 10.999 -9.680 1 1 B THR 0.590 1
ATOM 165 C CA . THR 25 25 ? A -18.327 12.422 -9.592 1 1 B THR 0.590 1
ATOM 166 C C . THR 25 25 ? A -18.122 12.877 -11.013 1 1 B THR 0.590 1
ATOM 167 O O . THR 25 25 ? A -17.360 12.266 -11.758 1 1 B THR 0.590 1
ATOM 168 C CB . THR 25 25 ? A -17.026 12.747 -8.871 1 1 B THR 0.590 1
ATOM 169 O OG1 . THR 25 25 ? A -17.030 12.360 -7.509 1 1 B THR 0.590 1
ATOM 170 C CG2 . THR 25 25 ? A -16.709 14.252 -8.850 1 1 B THR 0.590 1
ATOM 171 N N . ALA 26 26 ? A -18.803 13.953 -11.453 1 1 B ALA 0.500 1
ATOM 172 C CA . ALA 26 26 ? A -18.643 14.528 -12.783 1 1 B ALA 0.500 1
ATOM 173 C C . ALA 26 26 ? A -18.985 13.582 -13.937 1 1 B ALA 0.500 1
ATOM 174 O O . ALA 26 26 ? A -18.380 13.639 -15.006 1 1 B ALA 0.500 1
ATOM 175 C CB . ALA 26 26 ? A -17.237 15.162 -12.940 1 1 B ALA 0.500 1
ATOM 176 N N . PHE 27 27 ? A -19.995 12.705 -13.720 1 1 B PHE 0.540 1
ATOM 177 C CA . PHE 27 27 ? A -20.488 11.701 -14.655 1 1 B PHE 0.540 1
ATOM 178 C C . PHE 27 27 ? A -19.535 10.538 -14.844 1 1 B PHE 0.540 1
ATOM 179 O O . PHE 27 27 ? A -19.730 9.695 -15.725 1 1 B PHE 0.540 1
ATOM 180 C CB . PHE 27 27 ? A -20.901 12.292 -16.025 1 1 B PHE 0.540 1
ATOM 181 C CG . PHE 27 27 ? A -21.906 13.385 -15.832 1 1 B PHE 0.540 1
ATOM 182 C CD1 . PHE 27 27 ? A -23.192 13.056 -15.404 1 1 B PHE 0.540 1
ATOM 183 C CD2 . PHE 27 27 ? A -21.599 14.732 -16.076 1 1 B PHE 0.540 1
ATOM 184 C CE1 . PHE 27 27 ? A -24.193 14.027 -15.334 1 1 B PHE 0.540 1
ATOM 185 C CE2 . PHE 27 27 ? A -22.586 15.719 -15.961 1 1 B PHE 0.540 1
ATOM 186 C CZ . PHE 27 27 ? A -23.893 15.361 -15.620 1 1 B PHE 0.540 1
ATOM 187 N N . LEU 28 28 ? A -18.513 10.433 -13.979 1 1 B LEU 0.620 1
ATOM 188 C CA . LEU 28 28 ? A -17.468 9.450 -14.082 1 1 B LEU 0.620 1
ATOM 189 C C . LEU 28 28 ? A -17.237 8.772 -12.748 1 1 B LEU 0.620 1
ATOM 190 O O . LEU 28 28 ? A -17.358 9.376 -11.682 1 1 B LEU 0.620 1
ATOM 191 C CB . LEU 28 28 ? A -16.139 10.118 -14.500 1 1 B LEU 0.620 1
ATOM 192 C CG . LEU 28 28 ? A -16.118 10.826 -15.870 1 1 B LEU 0.620 1
ATOM 193 C CD1 . LEU 28 28 ? A -14.805 11.597 -16.088 1 1 B LEU 0.620 1
ATOM 194 C CD2 . LEU 28 28 ? A -16.300 9.793 -16.980 1 1 B LEU 0.620 1
ATOM 195 N N . CYS 29 29 ? A -16.905 7.470 -12.762 1 1 B CYS 0.650 1
ATOM 196 C CA . CYS 29 29 ? A -16.646 6.737 -11.542 1 1 B CYS 0.650 1
ATOM 197 C C . CYS 29 29 ? A -15.204 6.897 -11.107 1 1 B CYS 0.650 1
ATOM 198 O O . CYS 29 29 ? A -14.280 6.559 -11.843 1 1 B CYS 0.650 1
ATOM 199 C CB . CYS 29 29 ? A -16.966 5.242 -11.709 1 1 B CYS 0.650 1
ATOM 200 S SG . CYS 29 29 ? A -18.695 5.017 -12.198 1 1 B CYS 0.650 1
ATOM 201 N N . MET 30 30 ? A -14.977 7.419 -9.892 1 1 B MET 0.590 1
ATOM 202 C CA . MET 30 30 ? A -13.667 7.758 -9.387 1 1 B MET 0.590 1
ATOM 203 C C . MET 30 30 ? A -13.426 7.094 -8.053 1 1 B MET 0.590 1
ATOM 204 O O . MET 30 30 ? A -14.375 6.913 -7.288 1 1 B MET 0.590 1
ATOM 205 C CB . MET 30 30 ? A -13.546 9.284 -9.139 1 1 B MET 0.590 1
ATOM 206 C CG . MET 30 30 ? A -13.931 10.157 -10.353 1 1 B MET 0.590 1
ATOM 207 S SD . MET 30 30 ? A -13.781 11.963 -10.145 1 1 B MET 0.590 1
ATOM 208 C CE . MET 30 30 ? A -11.990 12.041 -10.013 1 1 B MET 0.590 1
ATOM 209 N N . LYS 31 31 ? A -12.160 6.751 -7.721 1 1 B LYS 0.620 1
ATOM 210 C CA . LYS 31 31 ? A -11.771 6.321 -6.398 1 1 B LYS 0.620 1
ATOM 211 C C . LYS 31 31 ? A -10.447 6.934 -5.933 1 1 B LYS 0.620 1
ATOM 212 O O . LYS 31 31 ? A -9.386 6.447 -6.302 1 1 B LYS 0.620 1
ATOM 213 C CB . LYS 31 31 ? A -11.502 4.821 -6.246 1 1 B LYS 0.620 1
ATOM 214 C CG . LYS 31 31 ? A -11.235 4.524 -4.769 1 1 B LYS 0.620 1
ATOM 215 C CD . LYS 31 31 ? A -10.811 3.089 -4.607 1 1 B LYS 0.620 1
ATOM 216 C CE . LYS 31 31 ? A -10.993 2.636 -3.176 1 1 B LYS 0.620 1
ATOM 217 N NZ . LYS 31 31 ? A -10.772 1.189 -3.150 1 1 B LYS 0.620 1
ATOM 218 N N . ASN 32 32 ? A -10.482 7.915 -5.009 1 1 B ASN 0.620 1
ATOM 219 C CA . ASN 32 32 ? A -9.283 8.667 -4.581 1 1 B ASN 0.620 1
ATOM 220 C C . ASN 32 32 ? A -8.212 9.050 -5.665 1 1 B ASN 0.620 1
ATOM 221 O O . ASN 32 32 ? A -8.548 9.050 -6.754 1 1 B ASN 0.620 1
ATOM 222 C CB . ASN 32 32 ? A -8.470 8.241 -3.376 1 1 B ASN 0.620 1
ATOM 223 C CG . ASN 32 32 ? A -9.392 7.751 -2.310 1 1 B ASN 0.620 1
ATOM 224 O OD1 . ASN 32 32 ? A -10.335 8.414 -1.889 1 1 B ASN 0.620 1
ATOM 225 N ND2 . ASN 32 32 ? A -9.061 6.511 -1.889 1 1 B ASN 0.620 1
ATOM 226 O OXT . ASN 32 32 ? A -7.079 9.510 -5.249 1 1 B ASN 0.620 1
#
#
loop_
_atom_type.symbol
C
N
O
S
#
#
loop_
_ma_qa_metric.id
_ma_qa_metric.name
_ma_qa_metric.description
_ma_qa_metric.type
_ma_qa_metric.mode
_ma_qa_metric.type_other_details
_ma_qa_metric.software_group_id
1 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].'
'pLDDT all-atom in [0,1]' local . 5
2 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].'
'pLDDT all-atom in [0,1]' global . 5
3 GMQE
'Global Model Quality Estimate of the model accuracy, calculated by SWISS-MODEL.'
'normalized score' global . 6
#
#
loop_
_ma_qa_metric_global.ordinal_id
_ma_qa_metric_global.model_id
_ma_qa_metric_global.metric_id
_ma_qa_metric_global.metric_value
1 1 2 0.562
2 1 3 0.496
#
#
loop_
_ma_qa_metric_local.ordinal_id
_ma_qa_metric_local.model_id
_ma_qa_metric_local.label_asym_id
_ma_qa_metric_local.label_seq_id
_ma_qa_metric_local.label_comp_id
_ma_qa_metric_local.metric_id
_ma_qa_metric_local.metric_value
1 1 A 3 PRO 1 0.450
2 1 A 4 ILE 1 0.490
3 1 A 5 GLN 1 0.490
4 1 A 6 CYS 1 0.630
5 1 A 7 ALA 1 0.600
6 1 A 8 GLU 1 0.560
7 1 A 9 THR 1 0.600
8 1 A 10 CYS 1 0.620
9 1 A 11 PHE 1 0.460
10 1 A 12 ILE 1 0.300
11 1 A 13 GLY 1 0.330
12 1 A 14 LYS 1 0.570
13 1 A 15 CYS 1 0.620
14 1 A 16 TYR 1 0.440
15 1 A 17 THR 1 0.620
16 1 A 18 GLU 1 0.590
17 1 A 19 GLU 1 0.610
18 1 A 20 LEU 1 0.490
19 1 A 21 GLY 1 0.660
20 1 A 22 CYS 1 0.680
21 1 A 23 THR 1 0.660
22 1 A 24 CYS 1 0.650
23 1 A 25 THR 1 0.590
24 1 A 26 ALA 1 0.500
25 1 A 27 PHE 1 0.540
26 1 A 28 LEU 1 0.620
27 1 A 29 CYS 1 0.650
28 1 A 30 MET 1 0.590
29 1 A 31 LYS 1 0.620
30 1 A 32 ASN 1 0.620
#
#
loop_
_pdbx_data_usage.id
_pdbx_data_usage.type
_pdbx_data_usage.details
_pdbx_data_usage.url
1 license
;This SWISS-MODEL protein model is copyright.
It is produced by the SWISS-MODEL server, developed by the Computational
Structural Biology Group at the SIB Swiss Institute of Bioinformatics at the
Biozentrum, University of Basel (https://swissmodel.expasy.org). This
model is licensed under the CC BY-SA 4.0 Creative Commons
Attribution-ShareAlike 4.0 International License
(https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
can copy and redistribute the model in any medium or format,
transform and build upon the model for any purpose, even
commercially, under the following terms:
Attribution - You must give appropriate credit, provide a link to
the license, and indicate if changes were made. You may do so in any
reasonable manner, but not in any way that suggests the licensor
endorses you or your use. When you publish, patent or distribute
results that were fully or partially based on the model, please cite
the corresponding papers mentioned under JRNL.
ShareAlike - If you remix, transform, or build upon the material,
you must distribute your contributions under the same license as the
original.
No additional restrictions - you may not apply legal terms or
technological measures that legally restrict others from doing
anything the license permits.
Find a human-readable summary of (and not a substitute for) the
CC BY-SA 4.0 license at this link:
https://creativecommons.org/licenses/by-sa/4.0/
;
https://creativecommons.org/licenses/by-sa/4.0/legalcode
2 disclaimer
;The SWISS-MODEL SERVER produces theoretical models for
proteins. The results of any theoretical modelling procedure is
NON-EXPERIMENTAL and MUST be considered with care. These models may
contain significant errors. This is especially true for automated
modeling since there is no human intervention during model
building. Please read the header section and the logfile carefully
to know what templates and alignments were used during the model
building process. All information by the SWISS-MODEL SERVER is
provided "AS-IS", without any warranty, expressed or implied.
;
https://swissmodel.expasy.org/docs/terms_of_use#disclaimer
#