data_SMR-1940ef91fb8cac95e43f1cbf7b1127ef_1 _entry.id SMR-1940ef91fb8cac95e43f1cbf7b1127ef_1 _struct.entry_id SMR-1940ef91fb8cac95e43f1cbf7b1127ef_1 _struct.pdbx_model_details ;This model was generated unsupervised by the SWISS-MODEL homology-modelling pipeline for the SWISS-MODEL Repository, a database of annotated 3D protein structure models. The modelled monomer covers following UniProtKB entries: - P84641/ CIRC_CHAPA, Circulin-C Estimated model accuracy of this model is 0.745, calculated by SWISS-MODEL as Global Model Quality Estimate (GMQE). ; _struct.pdbx_structure_determination_methodology computational _struct.title 'Model for UniProtKB entries P84641' _audit_conform.dict_location https://raw.githubusercontent.com/ihmwg/ModelCIF/80e1e22/dist/mmcif_ma.dic _audit_conform.dict_name mmcif_ma.dic _audit_conform.dict_version 1.4.7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'The SWISS-MODEL Repository - new features and functionality' 'Nucleic Acids Res.' 45 D313 D319 2017 27899672 10.1093/nar/gkw1132 2 'SWISS-MODEL: homology modelling of protein structures and complexes' 'Nucleic Acids Res.' 46 W296 W303 2018 29788355 10.1093/nar/gky427 3 'ProMod3 - A versatile homology modelling toolbox' 'PLoS Comput. Biol.' 17(1) 1 18 2021 33507980 10.1371/journal.pcbi.1008667 4 'QMEANDisCo - distance constraints applied on model quality estimation' Bioinformatics 36 1765 1771 2020 31697312 10.1093/bioinformatics/btz828 5 'OpenStructure: an integrated software framework for computational structural biology' 'Acta Crystallogr., Sect. D: Biol. Crystallogr.' 69 701 709 2013 23633579 10.1107/S0907444913007051 6 'BLAST+: architecture and applications' 'BMC Bioinf.' 10 421 . 2009 20003500 10.1186/1471-2105-10-421 7 'HH-suite3 for fast remote homology detection and deep protein annotation' 'BMC Bioinf.' 20 473 . 2019 31521110 10.1186/s12859-019-3019-7 # # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Bienert, S.' 1 primary 'Waterhouse, A.' 2 primary 'de Beer, T.A.P.' 3 primary 'Tauriello, G.' 4 primary 'Studer, G.' 5 primary 'Bordoli, L.' 6 primary 'Schwede, T.' 7 2 'Waterhouse, A.' 8 2 'Bertoni, M.' 9 2 'Bienert, S.' 10 2 'Studer, G.' 11 2 'Tauriello, G.' 12 2 'Gumienny, R.' 13 2 'Heer, F.T.' 14 2 'de Beer, T.A.P.' 15 2 'Rempfer, C.' 16 2 'Bordoli, L.' 17 2 'Lepore, R.' 18 2 'Schwede, T.' 19 3 'Studer, G.' 20 3 'Tauriello, G.' 21 3 'Bienert, S.' 22 3 'Biasini, M.' 23 3 'Johner, N.' 24 3 'Schwede, T.' 25 4 'Studer, G.' 26 4 'Rempfer, C.' 27 4 'Waterhouse, A.M.' 28 4 'Gumienny, R.' 29 4 'Haas, J.' 30 4 'Schwede, T.' 31 5 'Biasini, M.' 32 5 'Schmidt, T.' 33 5 'Bienert, S.' 34 5 'Mariani, V.' 35 5 'Studer, G.' 36 5 'Haas, J.' 37 5 'Johner, N.' 38 5 'Schenk, A.D.' 39 5 'Philippsen, A.' 40 5 'Schwede, T.' 41 6 'Camacho, C.' 42 6 'Coulouris, G.' 43 6 'Avagyan, V.' 44 6 'Ma, N.' 45 6 'Papadopoulos, J.' 46 6 'Bealer, K.' 47 6 'Madden, T.L.' 48 7 'Steinegger, M.' 49 7 'Meier, M.' 50 7 'Mirdita, M.' 51 7 'Vohringer, H.' 52 7 'Haunsberger, S.J.' 53 7 'Soding, J.' 54 # # loop_ _software.pdbx_ordinal _software.name _software.classification _software.description _software.version _software.type _software.location _software.citation_id 1 SWISS-MODEL 'model building' 'Homology modelling web service' 2025-06.3 package https://swissmodel.expasy.org 2 2 ProMod3 'model building' 'Modular homology modelling engine' 3.5.0 library https://git.scicore.unibas.ch/schwede/ProMod3 3 3 QMEAN 'model building' 'QMEAN - Qualitative Model Energy ANalysis' 4.4.0 library https://git.scicore.unibas.ch/schwede/QMEAN 4 4 OpenStructure 'data processing' 'Open-Source Computational Structural Biology Framework' 2.10.0 package https://openstructure.org/ 5 5 BLAST 'data collection' . 2.14.1 package https://blast.ncbi.nlm.nih.gov 6 6 HH-suite 'data collection' 'HH-suite3 for sensitive sequence searching' 3.2.0 package https://github.com/soedinglab/hh-suite 7 # # loop_ _ma_software_group.ordinal_id _ma_software_group.group_id _ma_software_group.software_id _ma_software_group.parameter_group_id 1 1 6 . 2 2 1 . 3 2 4 . 4 2 5 . 5 2 6 . 6 3 1 . 7 3 4 . 8 4 1 . 9 4 2 . 10 4 4 . 11 5 3 . 12 6 1 . 13 6 3 . 14 6 4 . # # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bienert, S.' 1 'Waterhouse, A.' 2 'de Beer, T.A.P.' 3 'Tauriello, G.' 4 'Studer, G.' 5 'Bordoli, L.' 6 'Schwede, T.' 7 # # loop_ _chem_comp.id _chem_comp.type _chem_comp.name _chem_comp.formula _chem_comp.formula_weight _chem_comp.ma_provenance ALA 'L-peptide linking' ALANINE 'C3 H7 N O2' 89.094 'CCD Core' ARG 'L-peptide linking' ARGININE 'C6 H15 N4 O2 1' 175.212 'CCD Core' ASN 'L-peptide linking' ASPARAGINE 'C4 H8 N2 O3' 132.119 'CCD Core' CYS 'L-peptide linking' CYSTEINE 'C3 H7 N O2 S' 121.154 'CCD Core' GLU 'L-peptide linking' 'GLUTAMIC ACID' 'C5 H9 N O4' 147.130 'CCD Core' GLY 'peptide linking' GLYCINE 'C2 H5 N O2' 75.067 'CCD Core' ILE 'L-peptide linking' ISOLEUCINE 'C6 H13 N O2' 131.175 'CCD Core' LYS 'L-peptide linking' LYSINE 'C6 H15 N2 O2 1' 147.198 'CCD Core' PHE 'L-peptide linking' PHENYLALANINE 'C9 H11 N O2' 165.192 'CCD Core' PRO 'L-peptide linking' PROLINE 'C5 H9 N O2' 115.132 'CCD Core' SER 'L-peptide linking' SERINE 'C3 H7 N O3' 105.093 'CCD Core' THR 'L-peptide linking' THREONINE 'C4 H9 N O3' 119.120 'CCD Core' TYR 'L-peptide linking' TYROSINE 'C9 H11 N O3' 181.191 'CCD Core' VAL 'L-peptide linking' VALINE 'C5 H11 N O2' 117.148 'CCD Core' # # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.details 1 polymer man . 3651.184 1 . # # loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.details 1 1 UNP CIRC_CHAPA P84641 1 GIPCGESCVFIPCITSVAGCSCKSKVCYRN Circulin-C # # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.seq_align_beg _struct_ref_seq.seq_align_end _struct_ref_seq.db_align_beg _struct_ref_seq.db_align_end 1 1 1 30 1 30 # # loop_ _ma_target_ref_db_details.target_entity_id _ma_target_ref_db_details.db_name _ma_target_ref_db_details.db_name_other_details _ma_target_ref_db_details.db_code _ma_target_ref_db_details.db_accession _ma_target_ref_db_details.seq_db_isoform _ma_target_ref_db_details.seq_db_align_begin _ma_target_ref_db_details.seq_db_align_end _ma_target_ref_db_details.ncbi_taxonomy_id _ma_target_ref_db_details.organism_scientific _ma_target_ref_db_details.seq_db_sequence_version_date _ma_target_ref_db_details.seq_db_sequence_checksum _ma_target_ref_db_details.is_primary 1 UNP . CIRC_CHAPA P84641 . 1 30 58431 'Chassalia parviflora' 2005-09-13 B9819A52FC9BA4E3 . # # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_strand_id _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can 1 polypeptide(L) no no A GIPCGESCVFIPCITSVAGCSCKSKVCYRN GIPCGESCVFIPCITSVAGCSCKSKVCYRN # # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY . 1 2 ILE . 1 3 PRO . 1 4 CYS . 1 5 GLY . 1 6 GLU . 1 7 SER . 1 8 CYS . 1 9 VAL . 1 10 PHE . 1 11 ILE . 1 12 PRO . 1 13 CYS . 1 14 ILE . 1 15 THR . 1 16 SER . 1 17 VAL . 1 18 ALA . 1 19 GLY . 1 20 CYS . 1 21 SER . 1 22 CYS . 1 23 LYS . 1 24 SER . 1 25 LYS . 1 26 VAL . 1 27 CYS . 1 28 TYR . 1 29 ARG . 1 30 ASN . # # loop_ _struct_asym.id _struct_asym.entity_id _struct_asym.details A 1 . # # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 GLY 1 1 GLY GLY A . A 1 2 ILE 2 2 ILE ILE A . A 1 3 PRO 3 3 PRO PRO A . A 1 4 CYS 4 4 CYS CYS A . A 1 5 GLY 5 5 GLY GLY A . A 1 6 GLU 6 6 GLU GLU A . A 1 7 SER 7 7 SER SER A . A 1 8 CYS 8 8 CYS CYS A . A 1 9 VAL 9 9 VAL VAL A . A 1 10 PHE 10 10 PHE PHE A . A 1 11 ILE 11 11 ILE ILE A . A 1 12 PRO 12 12 PRO PRO A . A 1 13 CYS 13 13 CYS CYS A . A 1 14 ILE 14 14 ILE ILE A . A 1 15 THR 15 15 THR THR A . A 1 16 SER 16 16 SER SER A . A 1 17 VAL 17 17 VAL VAL A . A 1 18 ALA 18 18 ALA ALA A . A 1 19 GLY 19 19 GLY GLY A . A 1 20 CYS 20 20 CYS CYS A . A 1 21 SER 21 21 SER SER A . A 1 22 CYS 22 22 CYS CYS A . A 1 23 LYS 23 23 LYS LYS A . A 1 24 SER 24 24 SER SER A . A 1 25 LYS 25 25 LYS LYS A . A 1 26 VAL 26 26 VAL VAL A . A 1 27 CYS 27 27 CYS CYS A . A 1 28 TYR 28 28 TYR TYR A . A 1 29 ARG 29 29 ARG ARG A . A 1 30 ASN 30 30 ASN ASN A . # # loop_ _ma_data.id _ma_data.name _ma_data.content_type _ma_data.content_type_other_details 1 'Cyclotide hyen-D {PDB ID=7rij, label_asym_id=A, auth_asym_id=A, SMTL ID=7rij.1.A}' 'template structure' . 2 . target . 3 'Target-template alignment by HHblits to 7rij, label_asym_id=A' 'target-template alignment' . 4 'model 1' 'model coordinates' . 5 SMTL 'reference database' . 6 PDB 'reference database' . 7 'Template search output' other 'Results of the sequence search' # # loop_ _ma_data_group.ordinal_id _ma_data_group.group_id _ma_data_group.data_id 1 1 2 2 1 5 3 1 6 4 2 7 5 3 2 6 3 1 7 3 3 8 4 1 9 4 3 10 5 4 # # loop_ _ma_data_ref_db.data_id _ma_data_ref_db.name _ma_data_ref_db.location_url _ma_data_ref_db.version _ma_data_ref_db.release_date 5 SMTL https://swissmodel.expasy.org/templates/ . 2025-06-25 6 PDB https://www.wwpdb.org . 2025-06-20 # # loop_ _ma_target_entity.entity_id _ma_target_entity.data_id _ma_target_entity.origin 1 2 'reference database' # # loop_ _ma_target_entity_instance.asym_id _ma_target_entity_instance.entity_id _ma_target_entity_instance.details A 1 . # # loop_ _ma_template_trans_matrix.id _ma_template_trans_matrix.rot_matrix[1][1] _ma_template_trans_matrix.rot_matrix[2][1] _ma_template_trans_matrix.rot_matrix[3][1] _ma_template_trans_matrix.rot_matrix[1][2] _ma_template_trans_matrix.rot_matrix[2][2] _ma_template_trans_matrix.rot_matrix[3][2] _ma_template_trans_matrix.rot_matrix[1][3] _ma_template_trans_matrix.rot_matrix[2][3] _ma_template_trans_matrix.rot_matrix[3][3] _ma_template_trans_matrix.tr_vector[1] _ma_template_trans_matrix.tr_vector[2] _ma_template_trans_matrix.tr_vector[3] 1 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0 0 0 # # loop_ _ma_template_details.ordinal_id _ma_template_details.template_id _ma_template_details.template_origin _ma_template_details.template_entity_type _ma_template_details.template_trans_matrix_id _ma_template_details.template_data_id _ma_template_details.target_asym_id _ma_template_details.template_label_asym_id _ma_template_details.template_label_entity_id _ma_template_details.template_model_num _ma_template_details.template_auth_asym_id 1 1 'reference database' polymer 1 1 A A 1 1 A # # loop_ _ma_template_poly.template_id _ma_template_poly.seq_one_letter_code _ma_template_poly.seq_one_letter_code_can 1 GFPCGESCVYGPCFTAAIGCSCKSKVCYKN GFPCGESCVYGPCFTAAIGCSCKSKVCYKN # # loop_ _ma_template_poly_segment.id _ma_template_poly_segment.template_id _ma_template_poly_segment.residue_number_begin _ma_template_poly_segment.residue_number_end 1 1 1 30 # # loop_ _ma_template_ref_db_details.template_id _ma_template_ref_db_details.db_name _ma_template_ref_db_details.db_name_other_details _ma_template_ref_db_details.db_accession_code _ma_template_ref_db_details.db_version_date 1 PDB . 7rij 2024-11-13 # # loop_ _ma_target_template_poly_mapping.id _ma_target_template_poly_mapping.template_segment_id _ma_target_template_poly_mapping.target_asym_id _ma_target_template_poly_mapping.target_seq_id_begin _ma_target_template_poly_mapping.target_seq_id_end 1 1 A 1 30 # # loop_ _ma_alignment_info.alignment_id _ma_alignment_info.data_id _ma_alignment_info.software_group_id _ma_alignment_info.alignment_length _ma_alignment_info.alignment_type _ma_alignment_info.alignment_mode 1 3 1 30 'target-template pairwise alignment' local # # loop_ _ma_alignment_details.ordinal_id _ma_alignment_details.alignment_id _ma_alignment_details.template_segment_id _ma_alignment_details.target_asym_id _ma_alignment_details.score_type _ma_alignment_details.score_type_other_details _ma_alignment_details.score_value _ma_alignment_details.percent_sequence_identity _ma_alignment_details.sequence_identity_denominator _ma_alignment_details.sequence_identity_denominator_other_details 1 1 1 A 'HHblits e-value' . 6.8e-19 73.333 'Number of aligned residue pairs (not including the gaps)' . # # loop_ _ma_alignment.ordinal_id _ma_alignment.alignment_id _ma_alignment.target_template_flag _ma_alignment.sequence 1 1 1 GIPCGESCVFIPCITSVAGCSCKSKVCYRN 2 1 2 GFPCGESCVYGPCFTAAIGCSCKSKVCYKN # # loop_ _ma_protocol_step.ordinal_id _ma_protocol_step.protocol_id _ma_protocol_step.step_id _ma_protocol_step.method_type _ma_protocol_step.step_name _ma_protocol_step.details _ma_protocol_step.software_group_id _ma_protocol_step.input_data_group_id _ma_protocol_step.output_data_group_id 1 1 1 'template search' 'template search' 'SWISS-MODEL template search in PDB' 2 1 2 2 1 2 'template selection' 'template selection' 'Automatic template selection by SWISS-MODEL {QSQE=0.000}' 3 2 4 3 1 3 modeling 'homology modeling' 'SWISS-MODEL auto-model mode using ProMod3 on 7rij.1' 4 3 5 # # loop_ _ma_model_list.ordinal_id _ma_model_list.model_name _ma_model_list.data_id _ma_model_list.model_type _ma_model_list.model_type_other_details 1 'model 1' 4 'Homology model' . # # loop_ _ma_model_group.id _ma_model_group.name _ma_model_group.details 1 . . # # loop_ _ma_model_group_link.group_id _ma_model_group_link.model_id 1 1 # # loop_ _atom_site.group_PDB _atom_site.id _atom_site.type_symbol _atom_site.label_atom_id _atom_site.label_alt_id _atom_site.label_comp_id _atom_site.label_seq_id _atom_site.auth_seq_id _atom_site.pdbx_PDB_ins_code _atom_site.label_asym_id _atom_site.Cartn_x _atom_site.Cartn_y _atom_site.Cartn_z _atom_site.occupancy _atom_site.label_entity_id _atom_site.auth_asym_id _atom_site.auth_comp_id _atom_site.B_iso_or_equiv _atom_site.pdbx_PDB_model_num ATOM 1 N N . GLY 1 1 ? A 6.218 -9.857 -15.173 1 1 A GLY 0.460 1 ATOM 2 C CA . GLY 1 1 ? A 7.255 -10.907 -15.120 1 1 A GLY 0.460 1 ATOM 3 C C . GLY 1 1 ? A 8.662 -10.421 -14.733 1 1 A GLY 0.460 1 ATOM 4 O O . GLY 1 1 ? A 9.461 -11.199 -14.358 1 1 A GLY 0.460 1 ATOM 5 N N . ILE 2 2 ? A 8.880 -9.058 -14.810 1 1 A ILE 0.480 1 ATOM 6 C CA . ILE 2 2 ? A 10.190 -8.498 -14.426 1 1 A ILE 0.480 1 ATOM 7 C C . ILE 2 2 ? A 10.101 -7.825 -13.054 1 1 A ILE 0.480 1 ATOM 8 O O . ILE 2 2 ? A 9.129 -7.094 -12.807 1 1 A ILE 0.480 1 ATOM 9 C CB . ILE 2 2 ? A 10.730 -7.478 -15.440 1 1 A ILE 0.480 1 ATOM 10 C CG1 . ILE 2 2 ? A 10.902 -8.143 -16.825 1 1 A ILE 0.480 1 ATOM 11 C CG2 . ILE 2 2 ? A 12.092 -6.839 -15.018 1 1 A ILE 0.480 1 ATOM 12 C CD1 . ILE 2 2 ? A 11.237 -7.142 -17.937 1 1 A ILE 0.480 1 ATOM 13 N N . PRO 3 3 ? A 11.032 -8.023 -12.102 1 1 A PRO 0.830 1 ATOM 14 C CA . PRO 3 3 ? A 10.959 -7.409 -10.778 1 1 A PRO 0.830 1 ATOM 15 C C . PRO 3 3 ? A 11.284 -5.927 -10.836 1 1 A PRO 0.830 1 ATOM 16 O O . PRO 3 3 ? A 12.172 -5.514 -11.582 1 1 A PRO 0.830 1 ATOM 17 C CB . PRO 3 3 ? A 12.000 -8.183 -9.947 1 1 A PRO 0.830 1 ATOM 18 C CG . PRO 3 3 ? A 13.047 -8.614 -10.976 1 1 A PRO 0.830 1 ATOM 19 C CD . PRO 3 3 ? A 12.209 -8.894 -12.223 1 1 A PRO 0.830 1 ATOM 20 N N . CYS 4 4 ? A 10.579 -5.101 -10.037 1 1 A CYS 0.840 1 ATOM 21 C CA . CYS 4 4 ? A 10.774 -3.658 -10.042 1 1 A CYS 0.840 1 ATOM 22 C C . CYS 4 4 ? A 11.702 -3.185 -8.940 1 1 A CYS 0.840 1 ATOM 23 O O . CYS 4 4 ? A 11.896 -1.986 -8.753 1 1 A CYS 0.840 1 ATOM 24 C CB . CYS 4 4 ? A 9.420 -2.938 -9.904 1 1 A CYS 0.840 1 ATOM 25 S SG . CYS 4 4 ? A 8.318 -3.405 -11.271 1 1 A CYS 0.840 1 ATOM 26 N N . GLY 5 5 ? A 12.303 -4.122 -8.176 1 1 A GLY 0.840 1 ATOM 27 C CA . GLY 5 5 ? A 13.243 -3.794 -7.110 1 1 A GLY 0.840 1 ATOM 28 C C . GLY 5 5 ? A 12.595 -3.271 -5.866 1 1 A GLY 0.840 1 ATOM 29 O O . GLY 5 5 ? A 13.139 -2.396 -5.197 1 1 A GLY 0.840 1 ATOM 30 N N . GLU 6 6 ? A 11.419 -3.812 -5.515 1 1 A GLU 0.810 1 ATOM 31 C CA . GLU 6 6 ? A 10.663 -3.361 -4.375 1 1 A GLU 0.810 1 ATOM 32 C C . GLU 6 6 ? A 9.859 -4.551 -3.873 1 1 A GLU 0.810 1 ATOM 33 O O . GLU 6 6 ? A 9.500 -5.445 -4.660 1 1 A GLU 0.810 1 ATOM 34 C CB . GLU 6 6 ? A 9.739 -2.172 -4.763 1 1 A GLU 0.810 1 ATOM 35 C CG . GLU 6 6 ? A 9.017 -1.483 -3.579 1 1 A GLU 0.810 1 ATOM 36 C CD . GLU 6 6 ? A 8.058 -0.379 -4.011 1 1 A GLU 0.810 1 ATOM 37 O OE1 . GLU 6 6 ? A 7.857 0.588 -3.239 1 1 A GLU 0.810 1 ATOM 38 O OE2 . GLU 6 6 ? A 7.459 -0.490 -5.112 1 1 A GLU 0.810 1 ATOM 39 N N . SER 7 7 ? A 9.576 -4.636 -2.561 1 1 A SER 0.830 1 ATOM 40 C CA . SER 7 7 ? A 8.683 -5.627 -1.988 1 1 A SER 0.830 1 ATOM 41 C C . SER 7 7 ? A 7.504 -4.939 -1.341 1 1 A SER 0.830 1 ATOM 42 O O . SER 7 7 ? A 7.517 -3.747 -1.048 1 1 A SER 0.830 1 ATOM 43 C CB . SER 7 7 ? A 9.354 -6.612 -0.981 1 1 A SER 0.830 1 ATOM 44 O OG . SER 7 7 ? A 9.875 -5.948 0.172 1 1 A SER 0.830 1 ATOM 45 N N . CYS 8 8 ? A 6.420 -5.699 -1.138 1 1 A CYS 0.790 1 ATOM 46 C CA . CYS 8 8 ? A 5.136 -5.174 -0.719 1 1 A CYS 0.790 1 ATOM 47 C C . CYS 8 8 ? A 4.544 -6.122 0.297 1 1 A CYS 0.790 1 ATOM 48 O O . CYS 8 8 ? A 3.378 -6.514 0.240 1 1 A CYS 0.790 1 ATOM 49 C CB . CYS 8 8 ? A 4.175 -4.971 -1.918 1 1 A CYS 0.790 1 ATOM 50 S SG . CYS 8 8 ? A 4.161 -6.384 -3.068 1 1 A CYS 0.790 1 ATOM 51 N N . VAL 9 9 ? A 5.372 -6.560 1.268 1 1 A VAL 0.650 1 ATOM 52 C CA . VAL 9 9 ? A 4.924 -7.375 2.393 1 1 A VAL 0.650 1 ATOM 53 C C . VAL 9 9 ? A 3.948 -6.647 3.313 1 1 A VAL 0.650 1 ATOM 54 O O . VAL 9 9 ? A 2.922 -7.217 3.709 1 1 A VAL 0.650 1 ATOM 55 C CB . VAL 9 9 ? A 6.095 -7.883 3.241 1 1 A VAL 0.650 1 ATOM 56 C CG1 . VAL 9 9 ? A 5.585 -8.828 4.356 1 1 A VAL 0.650 1 ATOM 57 C CG2 . VAL 9 9 ? A 7.136 -8.608 2.361 1 1 A VAL 0.650 1 ATOM 58 N N . PHE 10 10 ? A 4.263 -5.377 3.658 1 1 A PHE 0.610 1 ATOM 59 C CA . PHE 10 10 ? A 3.489 -4.554 4.572 1 1 A PHE 0.610 1 ATOM 60 C C . PHE 10 10 ? A 3.132 -3.196 3.974 1 1 A PHE 0.610 1 ATOM 61 O O . PHE 10 10 ? A 2.099 -2.618 4.307 1 1 A PHE 0.610 1 ATOM 62 C CB . PHE 10 10 ? A 4.285 -4.285 5.877 1 1 A PHE 0.610 1 ATOM 63 C CG . PHE 10 10 ? A 4.544 -5.557 6.634 1 1 A PHE 0.610 1 ATOM 64 C CD1 . PHE 10 10 ? A 3.503 -6.172 7.341 1 1 A PHE 0.610 1 ATOM 65 C CD2 . PHE 10 10 ? A 5.819 -6.144 6.676 1 1 A PHE 0.610 1 ATOM 66 C CE1 . PHE 10 10 ? A 3.720 -7.349 8.063 1 1 A PHE 0.610 1 ATOM 67 C CE2 . PHE 10 10 ? A 6.041 -7.322 7.398 1 1 A PHE 0.610 1 ATOM 68 C CZ . PHE 10 10 ? A 4.990 -7.928 8.091 1 1 A PHE 0.610 1 ATOM 69 N N . ILE 11 11 ? A 3.966 -2.652 3.064 1 1 A ILE 0.620 1 ATOM 70 C CA . ILE 11 11 ? A 3.760 -1.371 2.406 1 1 A ILE 0.620 1 ATOM 71 C C . ILE 11 11 ? A 3.227 -1.600 0.990 1 1 A ILE 0.620 1 ATOM 72 O O . ILE 11 11 ? A 3.327 -2.729 0.504 1 1 A ILE 0.620 1 ATOM 73 C CB . ILE 11 11 ? A 5.055 -0.551 2.415 1 1 A ILE 0.620 1 ATOM 74 C CG1 . ILE 11 11 ? A 6.211 -1.199 1.602 1 1 A ILE 0.620 1 ATOM 75 C CG2 . ILE 11 11 ? A 5.386 -0.183 3.888 1 1 A ILE 0.620 1 ATOM 76 C CD1 . ILE 11 11 ? A 7.303 -0.175 1.276 1 1 A ILE 0.620 1 ATOM 77 N N . PRO 12 12 ? A 2.618 -0.650 0.265 1 1 A PRO 0.770 1 ATOM 78 C CA . PRO 12 12 ? A 2.311 -0.829 -1.147 1 1 A PRO 0.770 1 ATOM 79 C C . PRO 12 12 ? A 3.555 -0.852 -2.008 1 1 A PRO 0.770 1 ATOM 80 O O . PRO 12 12 ? A 4.632 -0.474 -1.537 1 1 A PRO 0.770 1 ATOM 81 C CB . PRO 12 12 ? A 1.438 0.397 -1.475 1 1 A PRO 0.770 1 ATOM 82 C CG . PRO 12 12 ? A 1.969 1.501 -0.558 1 1 A PRO 0.770 1 ATOM 83 C CD . PRO 12 12 ? A 2.462 0.746 0.676 1 1 A PRO 0.770 1 ATOM 84 N N . CYS 13 13 ? A 3.421 -1.246 -3.289 1 1 A CYS 0.820 1 ATOM 85 C CA . CYS 13 13 ? A 4.430 -0.980 -4.294 1 1 A CYS 0.820 1 ATOM 86 C C . CYS 13 13 ? A 4.320 0.470 -4.695 1 1 A CYS 0.820 1 ATOM 87 O O . CYS 13 13 ? A 3.354 0.832 -5.390 1 1 A CYS 0.820 1 ATOM 88 C CB . CYS 13 13 ? A 4.220 -1.811 -5.590 1 1 A CYS 0.820 1 ATOM 89 S SG . CYS 13 13 ? A 4.316 -3.592 -5.321 1 1 A CYS 0.820 1 ATOM 90 N N . ILE 14 14 ? A 5.276 1.334 -4.321 1 1 A ILE 0.760 1 ATOM 91 C CA . ILE 14 14 ? A 5.390 2.704 -4.790 1 1 A ILE 0.760 1 ATOM 92 C C . ILE 14 14 ? A 5.825 2.665 -6.251 1 1 A ILE 0.760 1 ATOM 93 O O . ILE 14 14 ? A 5.507 3.553 -7.042 1 1 A ILE 0.760 1 ATOM 94 C CB . ILE 14 14 ? A 6.330 3.542 -3.913 1 1 A ILE 0.760 1 ATOM 95 C CG1 . ILE 14 14 ? A 5.707 3.723 -2.501 1 1 A ILE 0.760 1 ATOM 96 C CG2 . ILE 14 14 ? A 6.668 4.916 -4.559 1 1 A ILE 0.760 1 ATOM 97 C CD1 . ILE 14 14 ? A 6.682 4.307 -1.469 1 1 A ILE 0.760 1 ATOM 98 N N . THR 15 15 ? A 6.478 1.570 -6.709 1 1 A THR 0.760 1 ATOM 99 C CA . THR 15 15 ? A 6.700 1.328 -8.136 1 1 A THR 0.760 1 ATOM 100 C C . THR 15 15 ? A 5.442 1.130 -8.967 1 1 A THR 0.760 1 ATOM 101 O O . THR 15 15 ? A 5.517 1.056 -10.199 1 1 A THR 0.760 1 ATOM 102 C CB . THR 15 15 ? A 7.675 0.201 -8.466 1 1 A THR 0.760 1 ATOM 103 O OG1 . THR 15 15 ? A 7.240 -1.049 -7.987 1 1 A THR 0.760 1 ATOM 104 C CG2 . THR 15 15 ? A 9.032 0.535 -7.843 1 1 A THR 0.760 1 ATOM 105 N N . SER 16 16 ? A 4.229 1.130 -8.360 1 1 A SER 0.780 1 ATOM 106 C CA . SER 16 16 ? A 2.948 1.265 -9.054 1 1 A SER 0.780 1 ATOM 107 C C . SER 16 16 ? A 2.877 2.529 -9.885 1 1 A SER 0.780 1 ATOM 108 O O . SER 16 16 ? A 2.212 2.552 -10.921 1 1 A SER 0.780 1 ATOM 109 C CB . SER 16 16 ? A 1.687 1.216 -8.141 1 1 A SER 0.780 1 ATOM 110 O OG . SER 16 16 ? A 1.588 2.355 -7.285 1 1 A SER 0.780 1 ATOM 111 N N . VAL 17 17 ? A 3.639 3.580 -9.491 1 1 A VAL 0.670 1 ATOM 112 C CA . VAL 17 17 ? A 3.855 4.813 -10.245 1 1 A VAL 0.670 1 ATOM 113 C C . VAL 17 17 ? A 4.379 4.532 -11.654 1 1 A VAL 0.670 1 ATOM 114 O O . VAL 17 17 ? A 3.973 5.190 -12.620 1 1 A VAL 0.670 1 ATOM 115 C CB . VAL 17 17 ? A 4.775 5.787 -9.484 1 1 A VAL 0.670 1 ATOM 116 C CG1 . VAL 17 17 ? A 5.077 7.057 -10.316 1 1 A VAL 0.670 1 ATOM 117 C CG2 . VAL 17 17 ? A 4.095 6.194 -8.155 1 1 A VAL 0.670 1 ATOM 118 N N . ALA 18 18 ? A 5.251 3.517 -11.838 1 1 A ALA 0.730 1 ATOM 119 C CA . ALA 18 18 ? A 5.784 3.138 -13.132 1 1 A ALA 0.730 1 ATOM 120 C C . ALA 18 18 ? A 5.106 1.877 -13.670 1 1 A ALA 0.730 1 ATOM 121 O O . ALA 18 18 ? A 5.581 1.238 -14.612 1 1 A ALA 0.730 1 ATOM 122 C CB . ALA 18 18 ? A 7.316 2.982 -13.047 1 1 A ALA 0.730 1 ATOM 123 N N . GLY 19 19 ? A 3.939 1.493 -13.104 1 1 A GLY 0.790 1 ATOM 124 C CA . GLY 19 19 ? A 3.123 0.407 -13.625 1 1 A GLY 0.790 1 ATOM 125 C C . GLY 19 19 ? A 3.360 -0.940 -13.017 1 1 A GLY 0.790 1 ATOM 126 O O . GLY 19 19 ? A 2.889 -1.949 -13.539 1 1 A GLY 0.790 1 ATOM 127 N N . CYS 20 20 ? A 4.110 -1.015 -11.911 1 1 A CYS 0.830 1 ATOM 128 C CA . CYS 20 20 ? A 4.316 -2.262 -11.201 1 1 A CYS 0.830 1 ATOM 129 C C . CYS 20 20 ? A 3.167 -2.601 -10.274 1 1 A CYS 0.830 1 ATOM 130 O O . CYS 20 20 ? A 2.311 -1.785 -9.935 1 1 A CYS 0.830 1 ATOM 131 C CB . CYS 20 20 ? A 5.633 -2.272 -10.405 1 1 A CYS 0.830 1 ATOM 132 S SG . CYS 20 20 ? A 7.056 -1.835 -11.450 1 1 A CYS 0.830 1 ATOM 133 N N . SER 21 21 ? A 3.101 -3.861 -9.832 1 1 A SER 0.840 1 ATOM 134 C CA . SER 21 21 ? A 2.046 -4.293 -8.954 1 1 A SER 0.840 1 ATOM 135 C C . SER 21 21 ? A 2.529 -5.374 -8.051 1 1 A SER 0.840 1 ATOM 136 O O . SER 21 21 ? A 3.528 -6.044 -8.324 1 1 A SER 0.840 1 ATOM 137 C CB . SER 21 21 ? A 0.756 -4.766 -9.699 1 1 A SER 0.840 1 ATOM 138 O OG . SER 21 21 ? A 0.938 -5.801 -10.653 1 1 A SER 0.840 1 ATOM 139 N N . CYS 22 22 ? A 1.836 -5.542 -6.909 1 1 A CYS 0.830 1 ATOM 140 C CA . CYS 22 22 ? A 2.216 -6.478 -5.881 1 1 A CYS 0.830 1 ATOM 141 C C . CYS 22 22 ? A 1.793 -7.879 -6.271 1 1 A CYS 0.830 1 ATOM 142 O O . CYS 22 22 ? A 0.608 -8.159 -6.455 1 1 A CYS 0.830 1 ATOM 143 C CB . CYS 22 22 ? A 1.591 -6.079 -4.516 1 1 A CYS 0.830 1 ATOM 144 S SG . CYS 22 22 ? A 2.244 -7.024 -3.114 1 1 A CYS 0.830 1 ATOM 145 N N . LYS 23 23 ? A 2.763 -8.794 -6.438 1 1 A LYS 0.750 1 ATOM 146 C CA . LYS 23 23 ? A 2.492 -10.163 -6.799 1 1 A LYS 0.750 1 ATOM 147 C C . LYS 23 23 ? A 3.211 -11.037 -5.815 1 1 A LYS 0.750 1 ATOM 148 O O . LYS 23 23 ? A 4.437 -11.146 -5.841 1 1 A LYS 0.750 1 ATOM 149 C CB . LYS 23 23 ? A 3.028 -10.459 -8.223 1 1 A LYS 0.750 1 ATOM 150 C CG . LYS 23 23 ? A 2.358 -9.613 -9.313 1 1 A LYS 0.750 1 ATOM 151 C CD . LYS 23 23 ? A 0.871 -9.979 -9.484 1 1 A LYS 0.750 1 ATOM 152 C CE . LYS 23 23 ? A -0 -8.904 -10.127 1 1 A LYS 0.750 1 ATOM 153 N NZ . LYS 23 23 ? A 0.588 -8.510 -11.418 1 1 A LYS 0.750 1 ATOM 154 N N . SER 24 24 ? A 2.459 -11.656 -4.886 1 1 A SER 0.670 1 ATOM 155 C CA . SER 24 24 ? A 2.996 -12.492 -3.822 1 1 A SER 0.670 1 ATOM 156 C C . SER 24 24 ? A 4.117 -11.853 -3.041 1 1 A SER 0.670 1 ATOM 157 O O . SER 24 24 ? A 5.147 -12.479 -2.752 1 1 A SER 0.670 1 ATOM 158 C CB . SER 24 24 ? A 3.322 -13.929 -4.261 1 1 A SER 0.670 1 ATOM 159 O OG . SER 24 24 ? A 2.106 -14.606 -4.575 1 1 A SER 0.670 1 ATOM 160 N N . LYS 25 25 ? A 3.898 -10.584 -2.645 1 1 A LYS 0.710 1 ATOM 161 C CA . LYS 25 25 ? A 4.724 -9.769 -1.770 1 1 A LYS 0.710 1 ATOM 162 C C . LYS 25 25 ? A 5.917 -9.124 -2.444 1 1 A LYS 0.710 1 ATOM 163 O O . LYS 25 25 ? A 6.721 -8.463 -1.785 1 1 A LYS 0.710 1 ATOM 164 C CB . LYS 25 25 ? A 5.159 -10.478 -0.468 1 1 A LYS 0.710 1 ATOM 165 C CG . LYS 25 25 ? A 4.051 -11.352 0.130 1 1 A LYS 0.710 1 ATOM 166 C CD . LYS 25 25 ? A 4.302 -11.747 1.584 1 1 A LYS 0.710 1 ATOM 167 C CE . LYS 25 25 ? A 3.146 -12.572 2.155 1 1 A LYS 0.710 1 ATOM 168 N NZ . LYS 25 25 ? A 2.128 -11.672 2.749 1 1 A LYS 0.710 1 ATOM 169 N N . VAL 26 26 ? A 6.028 -9.233 -3.777 1 1 A VAL 0.840 1 ATOM 170 C CA . VAL 26 26 ? A 7.116 -8.657 -4.541 1 1 A VAL 0.840 1 ATOM 171 C C . VAL 26 26 ? A 6.521 -7.813 -5.653 1 1 A VAL 0.840 1 ATOM 172 O O . VAL 26 26 ? A 5.499 -8.161 -6.248 1 1 A VAL 0.840 1 ATOM 173 C CB . VAL 26 26 ? A 8.043 -9.739 -5.090 1 1 A VAL 0.840 1 ATOM 174 C CG1 . VAL 26 26 ? A 9.227 -9.115 -5.863 1 1 A VAL 0.840 1 ATOM 175 C CG2 . VAL 26 26 ? A 8.568 -10.598 -3.918 1 1 A VAL 0.840 1 ATOM 176 N N . CYS 27 27 ? A 7.120 -6.642 -5.949 1 1 A CYS 0.850 1 ATOM 177 C CA . CYS 27 27 ? A 6.622 -5.751 -6.976 1 1 A CYS 0.850 1 ATOM 178 C C . CYS 27 27 ? A 7.193 -6.100 -8.341 1 1 A CYS 0.850 1 ATOM 179 O O . CYS 27 27 ? A 8.409 -6.198 -8.535 1 1 A CYS 0.850 1 ATOM 180 C CB . CYS 27 27 ? A 6.920 -4.278 -6.629 1 1 A CYS 0.850 1 ATOM 181 S SG . CYS 27 27 ? A 6.286 -3.858 -4.978 1 1 A CYS 0.850 1 ATOM 182 N N . TYR 28 28 ? A 6.304 -6.285 -9.330 1 1 A TYR 0.820 1 ATOM 183 C CA . TYR 28 28 ? A 6.629 -6.771 -10.654 1 1 A TYR 0.820 1 ATOM 184 C C . TYR 28 28 ? A 5.853 -5.982 -11.690 1 1 A TYR 0.820 1 ATOM 185 O O . TYR 28 28 ? A 4.753 -5.519 -11.411 1 1 A TYR 0.820 1 ATOM 186 C CB . TYR 28 28 ? A 6.132 -8.233 -10.817 1 1 A TYR 0.820 1 ATOM 187 C CG . TYR 28 28 ? A 7.139 -9.246 -10.377 1 1 A TYR 0.820 1 ATOM 188 C CD1 . TYR 28 28 ? A 8.008 -9.772 -11.333 1 1 A TYR 0.820 1 ATOM 189 C CD2 . TYR 28 28 ? A 7.186 -9.758 -9.076 1 1 A TYR 0.820 1 ATOM 190 C CE1 . TYR 28 28 ? A 8.934 -10.763 -11.004 1 1 A TYR 0.820 1 ATOM 191 C CE2 . TYR 28 28 ? A 8.102 -10.767 -8.745 1 1 A TYR 0.820 1 ATOM 192 C CZ . TYR 28 28 ? A 8.991 -11.259 -9.704 1 1 A TYR 0.820 1 ATOM 193 O OH . TYR 28 28 ? A 9.922 -12.264 -9.377 1 1 A TYR 0.820 1 ATOM 194 N N . ARG 29 29 ? A 6.396 -5.876 -12.931 1 1 A ARG 0.400 1 ATOM 195 C CA . ARG 29 29 ? A 5.690 -5.377 -14.095 1 1 A ARG 0.400 1 ATOM 196 C C . ARG 29 29 ? A 6.095 -6.184 -15.354 1 1 A ARG 0.400 1 ATOM 197 O O . ARG 29 29 ? A 7.249 -6.148 -15.747 1 1 A ARG 0.400 1 ATOM 198 C CB . ARG 29 29 ? A 6.065 -3.903 -14.374 1 1 A ARG 0.400 1 ATOM 199 C CG . ARG 29 29 ? A 5.352 -3.309 -15.596 1 1 A ARG 0.400 1 ATOM 200 C CD . ARG 29 29 ? A 5.840 -1.899 -15.906 1 1 A ARG 0.400 1 ATOM 201 N NE . ARG 29 29 ? A 5.029 -1.392 -17.064 1 1 A ARG 0.400 1 ATOM 202 C CZ . ARG 29 29 ? A 5.352 -1.513 -18.359 1 1 A ARG 0.400 1 ATOM 203 N NH1 . ARG 29 29 ? A 6.446 -2.163 -18.751 1 1 A ARG 0.400 1 ATOM 204 N NH2 . ARG 29 29 ? A 4.549 -0.988 -19.285 1 1 A ARG 0.400 1 ATOM 205 N N . ASN 30 30 ? A 5.157 -6.883 -16.052 1 1 A ASN 0.440 1 ATOM 206 C CA . ASN 30 30 ? A 5.337 -7.521 -17.371 1 1 A ASN 0.440 1 ATOM 207 C C . ASN 30 30 ? A 6.394 -8.557 -17.701 1 1 A ASN 0.440 1 ATOM 208 O O . ASN 30 30 ? A 7.611 -8.378 -17.322 1 1 A ASN 0.440 1 ATOM 209 C CB . ASN 30 30 ? A 5.448 -6.564 -18.548 1 1 A ASN 0.440 1 ATOM 210 C CG . ASN 30 30 ? A 4.196 -5.728 -18.655 1 1 A ASN 0.440 1 ATOM 211 O OD1 . ASN 30 30 ? A 3.052 -6.068 -18.343 1 1 A ASN 0.440 1 ATOM 212 N ND2 . ASN 30 30 ? A 4.475 -4.511 -19.153 1 1 A ASN 0.440 1 ATOM 213 O OXT . ASN 30 30 ? A 6.021 -9.651 -18.188 1 1 A ASN 0.440 1 # # loop_ _atom_type.symbol C N O S # # loop_ _ma_qa_metric.id _ma_qa_metric.name _ma_qa_metric.description _ma_qa_metric.type _ma_qa_metric.mode _ma_qa_metric.type_other_details _ma_qa_metric.software_group_id 1 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].' 'pLDDT all-atom in [0,1]' local . 5 2 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].' 'pLDDT all-atom in [0,1]' global . 5 3 GMQE 'Global Model Quality Estimate of the model accuracy, calculated by SWISS-MODEL.' 'normalized score' global . 6 # # loop_ _ma_qa_metric_global.ordinal_id _ma_qa_metric_global.model_id _ma_qa_metric_global.metric_id _ma_qa_metric_global.metric_value 1 1 2 0.727 2 1 3 0.745 # # loop_ _ma_qa_metric_local.ordinal_id _ma_qa_metric_local.model_id _ma_qa_metric_local.label_asym_id _ma_qa_metric_local.label_seq_id _ma_qa_metric_local.label_comp_id _ma_qa_metric_local.metric_id _ma_qa_metric_local.metric_value 1 1 A 1 GLY 1 0.460 2 1 A 2 ILE 1 0.480 3 1 A 3 PRO 1 0.830 4 1 A 4 CYS 1 0.840 5 1 A 5 GLY 1 0.840 6 1 A 6 GLU 1 0.810 7 1 A 7 SER 1 0.830 8 1 A 8 CYS 1 0.790 9 1 A 9 VAL 1 0.650 10 1 A 10 PHE 1 0.610 11 1 A 11 ILE 1 0.620 12 1 A 12 PRO 1 0.770 13 1 A 13 CYS 1 0.820 14 1 A 14 ILE 1 0.760 15 1 A 15 THR 1 0.760 16 1 A 16 SER 1 0.780 17 1 A 17 VAL 1 0.670 18 1 A 18 ALA 1 0.730 19 1 A 19 GLY 1 0.790 20 1 A 20 CYS 1 0.830 21 1 A 21 SER 1 0.840 22 1 A 22 CYS 1 0.830 23 1 A 23 LYS 1 0.750 24 1 A 24 SER 1 0.670 25 1 A 25 LYS 1 0.710 26 1 A 26 VAL 1 0.840 27 1 A 27 CYS 1 0.850 28 1 A 28 TYR 1 0.820 29 1 A 29 ARG 1 0.400 30 1 A 30 ASN 1 0.440 # # loop_ _pdbx_data_usage.id _pdbx_data_usage.type _pdbx_data_usage.details _pdbx_data_usage.url 1 license ;This SWISS-MODEL protein model is copyright. It is produced by the SWISS-MODEL server, developed by the Computational Structural Biology Group at the SIB Swiss Institute of Bioinformatics at the Biozentrum, University of Basel (https://swissmodel.expasy.org). This model is licensed under the CC BY-SA 4.0 Creative Commons Attribution-ShareAlike 4.0 International License (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you can copy and redistribute the model in any medium or format, transform and build upon the model for any purpose, even commercially, under the following terms: Attribution - You must give appropriate credit, provide a link to the license, and indicate if changes were made. You may do so in any reasonable manner, but not in any way that suggests the licensor endorses you or your use. When you publish, patent or distribute results that were fully or partially based on the model, please cite the corresponding papers mentioned under JRNL. ShareAlike - If you remix, transform, or build upon the material, you must distribute your contributions under the same license as the original. No additional restrictions - you may not apply legal terms or technological measures that legally restrict others from doing anything the license permits. Find a human-readable summary of (and not a substitute for) the CC BY-SA 4.0 license at this link: https://creativecommons.org/licenses/by-sa/4.0/ ; https://creativecommons.org/licenses/by-sa/4.0/legalcode 2 disclaimer ;The SWISS-MODEL SERVER produces theoretical models for proteins. The results of any theoretical modelling procedure is NON-EXPERIMENTAL and MUST be considered with care. These models may contain significant errors. This is especially true for automated modeling since there is no human intervention during model building. Please read the header section and the logfile carefully to know what templates and alignments were used during the model building process. All information by the SWISS-MODEL SERVER is provided "AS-IS", without any warranty, expressed or implied. ; https://swissmodel.expasy.org/docs/terms_of_use#disclaimer #