data_SMR-8f04604001cc8c3190c2862f8a833f70_1
_entry.id SMR-8f04604001cc8c3190c2862f8a833f70_1
_struct.entry_id SMR-8f04604001cc8c3190c2862f8a833f70_1
_struct.pdbx_model_details
;This model was generated unsupervised by the SWISS-MODEL homology-modelling pipeline for the SWISS-MODEL Repository, a database of annotated 3D protein structure models. The modelled monomer covers following UniProtKB entries:

  - P80919/ ACP_ERYLO, Acyl carrier protein

Estimated model accuracy of this model is 0.812, calculated by SWISS-MODEL as Global Model Quality Estimate (GMQE).
;
_struct.pdbx_structure_determination_methodology computational
_struct.title 'Model for UniProtKB entries P80919'
_audit_conform.dict_location https://raw.githubusercontent.com/ihmwg/ModelCIF/80e1e22/dist/mmcif_ma.dic
_audit_conform.dict_name mmcif_ma.dic
_audit_conform.dict_version 1.4.7
#
loop_
_citation.id
_citation.title
_citation.journal_abbrev
_citation.journal_volume
_citation.page_first
_citation.page_last
_citation.year
_citation.pdbx_database_id_PubMed
_citation.pdbx_database_id_DOI
primary 'The SWISS-MODEL Repository - new features and functionality'
'Nucleic Acids Res.' 45 D313 D319 2017 27899672 10.1093/nar/gkw1132
2 'SWISS-MODEL: homology modelling of protein structures and complexes'
'Nucleic Acids Res.' 46 W296 W303 2018 29788355 10.1093/nar/gky427
3 'ProMod3 - A versatile homology modelling toolbox' 'PLoS Comput. Biol.' 17(1)
1 18 2021 33507980 10.1371/journal.pcbi.1008667
4 'QMEANDisCo - distance constraints applied on model quality estimation'
Bioinformatics 36 1765 1771 2020 31697312 10.1093/bioinformatics/btz828
5
'OpenStructure: an integrated software framework for computational structural biology'
'Acta Crystallogr., Sect. D: Biol. Crystallogr.' 69 701 709 2013 23633579
10.1107/S0907444913007051
6 'BLAST+: architecture and applications' 'BMC Bioinf.' 10 421 . 2009 20003500
10.1186/1471-2105-10-421
7 'HH-suite3 for fast remote homology detection and deep protein annotation'
'BMC Bioinf.' 20 473 . 2019 31521110 10.1186/s12859-019-3019-7
#
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
primary 'Bienert, S.' 1
primary 'Waterhouse, A.' 2
primary 'de Beer, T.A.P.' 3
primary 'Tauriello, G.' 4
primary 'Studer, G.' 5
primary 'Bordoli, L.' 6
primary 'Schwede, T.' 7
2 'Waterhouse, A.' 8
2 'Bertoni, M.' 9
2 'Bienert, S.' 10
2 'Studer, G.' 11
2 'Tauriello, G.' 12
2 'Gumienny, R.' 13
2 'Heer, F.T.' 14
2 'de Beer, T.A.P.' 15
2 'Rempfer, C.' 16
2 'Bordoli, L.' 17
2 'Lepore, R.' 18
2 'Schwede, T.' 19
3 'Studer, G.' 20
3 'Tauriello, G.' 21
3 'Bienert, S.' 22
3 'Biasini, M.' 23
3 'Johner, N.' 24
3 'Schwede, T.' 25
4 'Studer, G.' 26
4 'Rempfer, C.' 27
4 'Waterhouse, A.M.' 28
4 'Gumienny, R.' 29
4 'Haas, J.' 30
4 'Schwede, T.' 31
5 'Biasini, M.' 32
5 'Schmidt, T.' 33
5 'Bienert, S.' 34
5 'Mariani, V.' 35
5 'Studer, G.' 36
5 'Haas, J.' 37
5 'Johner, N.' 38
5 'Schenk, A.D.' 39
5 'Philippsen, A.' 40
5 'Schwede, T.' 41
6 'Camacho, C.' 42
6 'Coulouris, G.' 43
6 'Avagyan, V.' 44
6 'Ma, N.' 45
6 'Papadopoulos, J.' 46
6 'Bealer, K.' 47
6 'Madden, T.L.' 48
7 'Steinegger, M.' 49
7 'Meier, M.' 50
7 'Mirdita, M.' 51
7 'Vohringer, H.' 52
7 'Haunsberger, S.J.' 53
7 'Soding, J.' 54
#
#
loop_
_software.pdbx_ordinal
_software.name
_software.classification
_software.description
_software.version
_software.type
_software.location
_software.citation_id
1 SWISS-MODEL 'model building' 'Homology modelling web service' 2025-06.3
package https://swissmodel.expasy.org 2
2 ProMod3 'model building' 'Modular homology modelling engine' 3.5.0 library
https://git.scicore.unibas.ch/schwede/ProMod3 3
3 QMEAN 'model building' 'QMEAN - Qualitative Model Energy ANalysis' 4.4.0
library https://git.scicore.unibas.ch/schwede/QMEAN 4
4 OpenStructure 'data processing'
'Open-Source Computational Structural Biology Framework' 2.10.0 package
https://openstructure.org/ 5
5 BLAST 'data collection' . 2.14.1 package https://blast.ncbi.nlm.nih.gov 6
6 HH-suite 'data collection' 'HH-suite3 for sensitive sequence searching' 3.2.0
package https://github.com/soedinglab/hh-suite 7
#
#
loop_
_ma_software_group.ordinal_id
_ma_software_group.group_id
_ma_software_group.software_id
_ma_software_group.parameter_group_id
1 1 5 .
2 2 1 .
3 2 4 .
4 2 5 .
5 2 6 .
6 3 1 .
7 3 4 .
8 4 1 .
9 4 2 .
10 4 4 .
11 5 3 .
12 6 1 .
13 6 3 .
14 6 4 .
#
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
'Bienert, S.' 1
'Waterhouse, A.' 2
'de Beer, T.A.P.' 3
'Tauriello, G.' 4
'Studer, G.' 5
'Bordoli, L.' 6
'Schwede, T.' 7
#
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.name
_chem_comp.formula
_chem_comp.formula_weight
_chem_comp.ma_provenance
ALA 'L-peptide linking' ALANINE 'C3 H7 N O2' 89.094 'CCD Core'
ARG 'L-peptide linking' ARGININE 'C6 H15 N4 O2 1' 175.212 'CCD Core'
ASP 'L-peptide linking' 'ASPARTIC ACID' 'C4 H7 N O4' 133.103 'CCD Core'
GLN 'L-peptide linking' GLUTAMINE 'C5 H10 N2 O3' 146.146 'CCD Core'
GLU 'L-peptide linking' 'GLUTAMIC ACID' 'C5 H9 N O4' 147.130 'CCD Core'
GLY 'peptide linking' GLYCINE 'C2 H5 N O2' 75.067 'CCD Core'
HIS 'L-peptide linking' HISTIDINE 'C6 H10 N3 O2 1' 156.165 'CCD Core'
ILE 'L-peptide linking' ISOLEUCINE 'C6 H13 N O2' 131.175 'CCD Core'
LEU 'L-peptide linking' LEUCINE 'C6 H13 N O2' 131.175 'CCD Core'
LYS 'L-peptide linking' LYSINE 'C6 H15 N2 O2 1' 147.198 'CCD Core'
MET 'L-peptide linking' METHIONINE 'C5 H11 N O2 S' 149.208 'CCD Core'
PHE 'L-peptide linking' PHENYLALANINE 'C9 H11 N O2' 165.192 'CCD Core'
PRO 'L-peptide linking' PROLINE 'C5 H9 N O2' 115.132 'CCD Core'
SER 'L-peptide linking' SERINE 'C3 H7 N O3' 105.093 'CCD Core'
THR 'L-peptide linking' THREONINE 'C4 H9 N O3' 119.120 'CCD Core'
VAL 'L-peptide linking' VALINE 'C5 H11 N O2' 117.148 'CCD Core'
#
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.details
1 polymer man . 3354.666 1 .
#
#
loop_
_struct_ref.id
_struct_ref.entity_id
_struct_ref.db_name
_struct_ref.db_code
_struct_ref.pdbx_db_accession
_struct_ref.pdbx_align_begin
_struct_ref.pdbx_seq_one_letter_code
_struct_ref.details
1 1 UNP ACP_ERYLO P80919 1 MSDTATRVQKIVVEHLGVESDKVTQE 'Acyl carrier protein'
#
#
loop_
_struct_ref_seq.align_id
_struct_ref_seq.ref_id
_struct_ref_seq.seq_align_beg
_struct_ref_seq.seq_align_end
_struct_ref_seq.db_align_beg
_struct_ref_seq.db_align_end
1 1 1 26 1 26
#
#
loop_
_ma_target_ref_db_details.target_entity_id
_ma_target_ref_db_details.db_name
_ma_target_ref_db_details.db_name_other_details
_ma_target_ref_db_details.db_code
_ma_target_ref_db_details.db_accession
_ma_target_ref_db_details.seq_db_isoform
_ma_target_ref_db_details.seq_db_align_begin
_ma_target_ref_db_details.seq_db_align_end
_ma_target_ref_db_details.ncbi_taxonomy_id
_ma_target_ref_db_details.organism_scientific
_ma_target_ref_db_details.seq_db_sequence_version_date
_ma_target_ref_db_details.seq_db_sequence_checksum
_ma_target_ref_db_details.is_primary
1 UNP . ACP_ERYLO P80919 . 1 26 1044 'Erythrobacter longus' 2007-01-23
38577CA06FF8D268 .
#
#
loop_
_entity_poly.entity_id
_entity_poly.type
_entity_poly.nstd_linkage
_entity_poly.nstd_monomer
_entity_poly.pdbx_strand_id
_entity_poly.pdbx_seq_one_letter_code
_entity_poly.pdbx_seq_one_letter_code_can
1 polypeptide(L) no no A MSDTATRVQKIVVEHLGVESDKVTQE MSDTATRVQKIVVEHLGVESDKVTQE
#
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 MET .
1 2 SER .
1 3 ASP .
1 4 THR .
1 5 ALA .
1 6 THR .
1 7 ARG .
1 8 VAL .
1 9 GLN .
1 10 LYS .
1 11 ILE .
1 12 VAL .
1 13 VAL .
1 14 GLU .
1 15 HIS .
1 16 LEU .
1 17 GLY .
1 18 VAL .
1 19 GLU .
1 20 SER .
1 21 ASP .
1 22 LYS .
1 23 VAL .
1 24 THR .
1 25 GLN .
1 26 GLU .
#
#
loop_
_struct_asym.id
_struct_asym.entity_id
_struct_asym.details
A 1 .
#
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
A 1 1 MET 1 1 MET MET A .
A 1 2 SER 2 2 SER SER A .
A 1 3 ASP 3 3 ASP ASP A .
A 1 4 THR 4 4 THR THR A .
A 1 5 ALA 5 5 ALA ALA A .
A 1 6 THR 6 6 THR THR A .
A 1 7 ARG 7 7 ARG ARG A .
A 1 8 VAL 8 8 VAL VAL A .
A 1 9 GLN 9 9 GLN GLN A .
A 1 10 LYS 10 10 LYS LYS A .
A 1 11 ILE 11 11 ILE ILE A .
A 1 12 VAL 12 12 VAL VAL A .
A 1 13 VAL 13 13 VAL VAL A .
A 1 14 GLU 14 14 GLU GLU A .
A 1 15 HIS 15 15 HIS HIS A .
A 1 16 LEU 16 16 LEU LEU A .
A 1 17 GLY 17 17 GLY GLY A .
A 1 18 VAL 18 18 VAL VAL A .
A 1 19 GLU 19 19 GLU GLU A .
A 1 20 SER 20 20 SER SER A .
A 1 21 ASP 21 21 ASP ASP A .
A 1 22 LYS 22 22 LYS LYS A .
A 1 23 VAL 23 23 VAL VAL A .
A 1 24 THR 24 24 THR THR A .
A 1 25 GLN 25 25 GLN GLN A .
A 1 26 GLU 26 ? ? ? A .
#
#
loop_
_ma_data.id
_ma_data.name
_ma_data.content_type
_ma_data.content_type_other_details
1
'Acyl carrier protein {PDB ID=2n57, label_asym_id=A, auth_asym_id=A, SMTL ID=2n57.1.A}'
'template structure' .
2 . target .
3 'Target-template alignment by BLAST to 2n57, label_asym_id=A'
'target-template alignment' .
4 'model 1' 'model coordinates' .
5 SMTL 'reference database' .
6 PDB 'reference database' .
7 'Template search output' other 'Results of the sequence search'
#
#
loop_
_ma_data_group.ordinal_id
_ma_data_group.group_id
_ma_data_group.data_id
1 1 2
2 1 5
3 1 6
4 2 7
5 3 2
6 3 1
7 3 3
8 4 1
9 4 3
10 5 4
#
#
loop_
_ma_data_ref_db.data_id
_ma_data_ref_db.name
_ma_data_ref_db.location_url
_ma_data_ref_db.version
_ma_data_ref_db.release_date
5 SMTL https://swissmodel.expasy.org/templates/ . 2025-06-25
6 PDB https://www.wwpdb.org . 2025-06-20
#
#
loop_
_ma_target_entity.entity_id
_ma_target_entity.data_id
_ma_target_entity.origin
1 2 'reference database'
#
#
loop_
_ma_target_entity_instance.asym_id
_ma_target_entity_instance.entity_id
_ma_target_entity_instance.details
A 1 .
#
#
loop_
_ma_template_trans_matrix.id
_ma_template_trans_matrix.rot_matrix[1][1]
_ma_template_trans_matrix.rot_matrix[2][1]
_ma_template_trans_matrix.rot_matrix[3][1]
_ma_template_trans_matrix.rot_matrix[1][2]
_ma_template_trans_matrix.rot_matrix[2][2]
_ma_template_trans_matrix.rot_matrix[3][2]
_ma_template_trans_matrix.rot_matrix[1][3]
_ma_template_trans_matrix.rot_matrix[2][3]
_ma_template_trans_matrix.rot_matrix[3][3]
_ma_template_trans_matrix.tr_vector[1]
_ma_template_trans_matrix.tr_vector[2]
_ma_template_trans_matrix.tr_vector[3]
1 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000
1.000000 0 0 0
#
#
loop_
_ma_template_details.ordinal_id
_ma_template_details.template_id
_ma_template_details.template_origin
_ma_template_details.template_entity_type
_ma_template_details.template_trans_matrix_id
_ma_template_details.template_data_id
_ma_template_details.target_asym_id
_ma_template_details.template_label_asym_id
_ma_template_details.template_label_entity_id
_ma_template_details.template_model_num
_ma_template_details.template_auth_asym_id
1 1 'reference database' polymer 1 1 A A 1 1 A
#
#
loop_
_ma_template_poly.template_id
_ma_template_poly.seq_one_letter_code
_ma_template_poly.seq_one_letter_code_can
1
;MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAAETILTVGDAV
KFIDKASA
;

;MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAAETILTVGDAV
KFIDKASA
;

#
#
loop_
_ma_template_poly_segment.id
_ma_template_poly_segment.template_id
_ma_template_poly_segment.residue_number_begin
_ma_template_poly_segment.residue_number_end
1 1 1 25
#
#
loop_
_ma_template_ref_db_details.template_id
_ma_template_ref_db_details.db_name
_ma_template_ref_db_details.db_name_other_details
_ma_template_ref_db_details.db_accession_code
_ma_template_ref_db_details.db_version_date
1 PDB . 2n57 2024-05-01
#
#
loop_
_ma_target_template_poly_mapping.id
_ma_target_template_poly_mapping.template_segment_id
_ma_target_template_poly_mapping.target_asym_id
_ma_target_template_poly_mapping.target_seq_id_begin
_ma_target_template_poly_mapping.target_seq_id_end
1 1 A 1 26
#
#
loop_
_ma_alignment_info.alignment_id
_ma_alignment_info.data_id
_ma_alignment_info.software_group_id
_ma_alignment_info.alignment_length
_ma_alignment_info.alignment_type
_ma_alignment_info.alignment_mode
1 3 1 26 'target-template pairwise alignment' local
#
#
loop_
_ma_alignment_details.ordinal_id
_ma_alignment_details.alignment_id
_ma_alignment_details.template_segment_id
_ma_alignment_details.target_asym_id
_ma_alignment_details.score_type
_ma_alignment_details.score_type_other_details
_ma_alignment_details.score_value
_ma_alignment_details.percent_sequence_identity
_ma_alignment_details.sequence_identity_denominator
_ma_alignment_details.sequence_identity_denominator_other_details
1 1 1 A 'BLAST e-value' . 5.43e-08 80.000
'Number of aligned residue pairs (not including the gaps)' .
#
#
loop_
_ma_alignment.ordinal_id
_ma_alignment.alignment_id
_ma_alignment.target_template_flag
_ma_alignment.sequence
1 1 1 MSDTATRVQKIVVEHLGVESDKVTQE
2 1 2 MSDTAERVKKIVVEHLGVDADKVTE-
#
#
loop_
_ma_protocol_step.ordinal_id
_ma_protocol_step.protocol_id
_ma_protocol_step.step_id
_ma_protocol_step.method_type
_ma_protocol_step.step_name
_ma_protocol_step.details
_ma_protocol_step.software_group_id
_ma_protocol_step.input_data_group_id
_ma_protocol_step.output_data_group_id
1 1 1 'template search' 'template search' 'SWISS-MODEL template search in PDB' 2
1 2
2 1 2 'template selection' 'template selection'
'Automatic template selection by SWISS-MODEL' 3 2 4
3 1 3 modeling 'homology modeling'
'SWISS-MODEL auto-model mode using ProMod3 on 2n57.1' 4 3 5
#
#
loop_
_ma_model_list.ordinal_id
_ma_model_list.model_name
_ma_model_list.data_id
_ma_model_list.model_type
_ma_model_list.model_type_other_details
1 'model 1' 4 'Homology model' .
#
#
loop_
_ma_model_group.id
_ma_model_group.name
_ma_model_group.details
1 . .
#
#
loop_
_ma_model_group_link.group_id
_ma_model_group_link.model_id
1 1
#
#
loop_
_atom_site.group_PDB
_atom_site.id
_atom_site.type_symbol
_atom_site.label_atom_id
_atom_site.label_alt_id
_atom_site.label_comp_id
_atom_site.label_seq_id
_atom_site.auth_seq_id
_atom_site.pdbx_PDB_ins_code
_atom_site.label_asym_id
_atom_site.Cartn_x
_atom_site.Cartn_y
_atom_site.Cartn_z
_atom_site.occupancy
_atom_site.label_entity_id
_atom_site.auth_asym_id
_atom_site.auth_comp_id
_atom_site.B_iso_or_equiv
_atom_site.pdbx_PDB_model_num
ATOM 1 N N . MET 1 1 ? A -1.532 -1.120 -2.875 1 1 A MET 0.640 1
ATOM 2 C CA . MET 1 1 ? A -0.614 -1.763 -3.888 1 1 A MET 0.640 1
ATOM 3 C C . MET 1 1 ? A 0.461 -2.690 -3.353 1 1 A MET 0.640 1
ATOM 4 O O . MET 1 1 ? A 0.876 -3.596 -4.046 1 1 A MET 0.640 1
ATOM 5 C CB . MET 1 1 ? A 0.100 -0.667 -4.741 1 1 A MET 0.640 1
ATOM 6 C CG . MET 1 1 ? A 0.958 0.371 -3.971 1 1 A MET 0.640 1
ATOM 7 S SD . MET 1 1 ? A 0.048 1.823 -3.360 1 1 A MET 0.640 1
ATOM 8 C CE . MET 1 1 ? A 0.660 2.905 -4.690 1 1 A MET 0.640 1
ATOM 9 N N . SER 2 2 ? A 0.947 -2.476 -2.118 1 1 A SER 0.700 1
ATOM 10 C CA . SER 2 2 ? A 1.969 -3.286 -1.504 1 1 A SER 0.700 1
ATOM 11 C C . SER 2 2 ? A 1.363 -4.419 -0.731 1 1 A SER 0.700 1
ATOM 12 O O . SER 2 2 ? A 0.359 -4.216 -0.051 1 1 A SER 0.700 1
ATOM 13 C CB . SER 2 2 ? A 2.654 -2.427 -0.426 1 1 A SER 0.700 1
ATOM 14 O OG . SER 2 2 ? A 3.226 -1.259 -1.009 1 1 A SER 0.700 1
ATOM 15 N N . ASP 3 3 ? A 1.979 -5.609 -0.775 1 1 A ASP 0.800 1
ATOM 16 C CA . ASP 3 3 ? A 1.464 -6.801 -0.139 1 1 A ASP 0.800 1
ATOM 17 C C . ASP 3 3 ? A 1.883 -6.871 1.320 1 1 A ASP 0.800 1
ATOM 18 O O . ASP 3 3 ? A 1.075 -7.012 2.240 1 1 A ASP 0.800 1
ATOM 19 C CB . ASP 3 3 ? A 2.033 -8.021 -0.904 1 1 A ASP 0.800 1
ATOM 20 C CG . ASP 3 3 ? A 1.642 -7.917 -2.370 1 1 A ASP 0.800 1
ATOM 21 O OD1 . ASP 3 3 ? A 0.556 -7.352 -2.652 1 1 A ASP 0.800 1
ATOM 22 O OD2 . ASP 3 3 ? A 2.461 -8.365 -3.207 1 1 A ASP 0.800 1
ATOM 23 N N . THR 4 4 ? A 3.203 -6.720 1.561 1 1 A THR 0.820 1
ATOM 24 C CA . THR 4 4 ? A 3.803 -6.737 2.891 1 1 A THR 0.820 1
ATOM 25 C C . THR 4 4 ? A 3.438 -5.532 3.734 1 1 A THR 0.820 1
ATOM 26 O O . THR 4 4 ? A 3.031 -5.673 4.875 1 1 A THR 0.820 1
ATOM 27 C CB . THR 4 4 ? A 5.325 -6.850 2.895 1 1 A THR 0.820 1
ATOM 28 O OG1 . THR 4 4 ? A 5.721 -7.853 1.980 1 1 A THR 0.820 1
ATOM 29 C CG2 . THR 4 4 ? A 5.829 -7.308 4.275 1 1 A THR 0.820 1
ATOM 30 N N . ALA 5 5 ? A 3.533 -4.299 3.179 1 1 A ALA 0.810 1
ATOM 31 C CA . ALA 5 5 ? A 3.290 -3.057 3.898 1 1 A ALA 0.810 1
ATOM 32 C C . ALA 5 5 ? A 1.876 -2.917 4.431 1 1 A ALA 0.810 1
ATOM 33 O O . ALA 5 5 ? A 1.680 -2.505 5.564 1 1 A ALA 0.810 1
ATOM 34 C CB . ALA 5 5 ? A 3.495 -1.833 2.983 1 1 A ALA 0.810 1
ATOM 35 N N . THR 6 6 ? A 0.865 -3.290 3.603 1 1 A THR 0.790 1
ATOM 36 C CA . THR 6 6 ? A -0.547 -3.373 3.976 1 1 A THR 0.790 1
ATOM 37 C C . THR 6 6 ? A -0.735 -4.376 5.083 1 1 A THR 0.790 1
ATOM 38 O O . THR 6 6 ? A -1.450 -4.121 6.040 1 1 A THR 0.790 1
ATOM 39 C CB . THR 6 6 ? A -1.474 -3.804 2.832 1 1 A THR 0.790 1
ATOM 40 O OG1 . THR 6 6 ? A -1.457 -2.853 1.786 1 1 A THR 0.790 1
ATOM 41 C CG2 . THR 6 6 ? A -2.957 -3.912 3.238 1 1 A THR 0.790 1
ATOM 42 N N . ARG 7 7 ? A -0.072 -5.553 5.003 1 1 A ARG 0.730 1
ATOM 43 C CA . ARG 7 7 ? A -0.138 -6.557 6.038 1 1 A ARG 0.730 1
ATOM 44 C C . ARG 7 7 ? A 0.469 -6.136 7.359 1 1 A ARG 0.730 1
ATOM 45 O O . ARG 7 7 ? A -0.176 -6.273 8.389 1 1 A ARG 0.730 1
ATOM 46 C CB . ARG 7 7 ? A 0.597 -7.824 5.564 1 1 A ARG 0.730 1
ATOM 47 C CG . ARG 7 7 ? A 0.132 -9.111 6.265 1 1 A ARG 0.730 1
ATOM 48 C CD . ARG 7 7 ? A 0.366 -10.340 5.379 1 1 A ARG 0.730 1
ATOM 49 N NE . ARG 7 7 ? A -0.806 -10.422 4.423 1 1 A ARG 0.730 1
ATOM 50 C CZ . ARG 7 7 ? A -1.998 -10.959 4.726 1 1 A ARG 0.730 1
ATOM 51 N NH1 . ARG 7 7 ? A -2.242 -11.457 5.934 1 1 A ARG 0.730 1
ATOM 52 N NH2 . ARG 7 7 ? A -2.965 -11.014 3.812 1 1 A ARG 0.730 1
ATOM 53 N N . VAL 8 8 ? A 1.700 -5.565 7.353 1 1 A VAL 0.820 1
ATOM 54 C CA . VAL 8 8 ? A 2.386 -5.074 8.544 1 1 A VAL 0.820 1
ATOM 55 C C . VAL 8 8 ? A 1.575 -3.965 9.162 1 1 A VAL 0.820 1
ATOM 56 O O . VAL 8 8 ? A 1.193 -4.046 10.316 1 1 A VAL 0.820 1
ATOM 57 C CB . VAL 8 8 ? A 3.800 -4.541 8.265 1 1 A VAL 0.820 1
ATOM 58 C CG1 . VAL 8 8 ? A 4.463 -3.951 9.539 1 1 A VAL 0.820 1
ATOM 59 C CG2 . VAL 8 8 ? A 4.682 -5.688 7.737 1 1 A VAL 0.820 1
ATOM 60 N N . GLN 9 9 ? A 1.191 -2.949 8.346 1 1 A GLN 0.770 1
ATOM 61 C CA . GLN 9 9 ? A 0.413 -1.817 8.799 1 1 A GLN 0.770 1
ATOM 62 C C . GLN 9 9 ? A -0.901 -2.230 9.433 1 1 A GLN 0.770 1
ATOM 63 O O . GLN 9 9 ? A -1.210 -1.818 10.539 1 1 A GLN 0.770 1
ATOM 64 C CB . GLN 9 9 ? A 0.113 -0.857 7.617 1 1 A GLN 0.770 1
ATOM 65 C CG . GLN 9 9 ? A -0.799 0.337 7.974 1 1 A GLN 0.770 1
ATOM 66 C CD . GLN 9 9 ? A -1.062 1.239 6.773 1 1 A GLN 0.770 1
ATOM 67 O OE1 . GLN 9 9 ? A -2.020 0.986 6.048 1 1 A GLN 0.770 1
ATOM 68 N NE2 . GLN 9 9 ? A -0.269 2.307 6.551 1 1 A GLN 0.770 1
ATOM 69 N N . LYS 10 10 ? A -1.668 -3.134 8.792 1 1 A LYS 0.770 1
ATOM 70 C CA . LYS 10 10 ? A -2.902 -3.662 9.337 1 1 A LYS 0.770 1
ATOM 71 C C . LYS 10 10 ? A -2.775 -4.342 10.685 1 1 A LYS 0.770 1
ATOM 72 O O . LYS 10 10 ? A -3.593 -4.110 11.568 1 1 A LYS 0.770 1
ATOM 73 C CB . LYS 10 10 ? A -3.439 -4.729 8.356 1 1 A LYS 0.770 1
ATOM 74 C CG . LYS 10 10 ? A -4.285 -4.130 7.226 1 1 A LYS 0.770 1
ATOM 75 C CD . LYS 10 10 ? A -5.749 -3.950 7.670 1 1 A LYS 0.770 1
ATOM 76 C CE . LYS 10 10 ? A -6.547 -5.258 7.800 1 1 A LYS 0.770 1
ATOM 77 N NZ . LYS 10 10 ? A -6.862 -5.748 6.444 1 1 A LYS 0.770 1
ATOM 78 N N . ILE 11 11 ? A -1.731 -5.179 10.869 1 1 A ILE 0.810 1
ATOM 79 C CA . ILE 11 11 ? A -1.410 -5.819 12.135 1 1 A ILE 0.810 1
ATOM 80 C C . ILE 11 11 ? A -1.058 -4.772 13.180 1 1 A ILE 0.810 1
ATOM 81 O O . ILE 11 11 ? A -1.578 -4.796 14.285 1 1 A ILE 0.810 1
ATOM 82 C CB . ILE 11 11 ? A -0.271 -6.833 11.992 1 1 A ILE 0.810 1
ATOM 83 C CG1 . ILE 11 11 ? A -0.634 -7.957 10.986 1 1 A ILE 0.810 1
ATOM 84 C CG2 . ILE 11 11 ? A 0.044 -7.476 13.363 1 1 A ILE 0.810 1
ATOM 85 C CD1 . ILE 11 11 ? A 0.590 -8.787 10.563 1 1 A ILE 0.810 1
ATOM 86 N N . VAL 12 12 ? A -0.227 -3.758 12.835 1 1 A VAL 0.820 1
ATOM 87 C CA . VAL 12 12 ? A 0.122 -2.658 13.728 1 1 A VAL 0.820 1
ATOM 88 C C . VAL 12 12 ? A -1.118 -1.897 14.180 1 1 A VAL 0.820 1
ATOM 89 O O . VAL 12 12 ? A -1.309 -1.664 15.366 1 1 A VAL 0.820 1
ATOM 90 C CB . VAL 12 12 ? A 1.128 -1.700 13.082 1 1 A VAL 0.820 1
ATOM 91 C CG1 . VAL 12 12 ? A 1.482 -0.539 14.030 1 1 A VAL 0.820 1
ATOM 92 C CG2 . VAL 12 12 ? A 2.450 -2.438 12.798 1 1 A VAL 0.820 1
ATOM 93 N N . VAL 13 13 ? A -2.040 -1.566 13.258 1 1 A VAL 0.810 1
ATOM 94 C CA . VAL 13 13 ? A -3.310 -0.918 13.550 1 1 A VAL 0.810 1
ATOM 95 C C . VAL 13 13 ? A -4.207 -1.752 14.441 1 1 A VAL 0.810 1
ATOM 96 O O . VAL 13 13 ? A -4.744 -1.252 15.418 1 1 A VAL 0.810 1
ATOM 97 C CB . VAL 13 13 ? A -4.018 -0.545 12.263 1 1 A VAL 0.810 1
ATOM 98 C CG1 . VAL 13 13 ? A -5.354 0.170 12.546 1 1 A VAL 0.810 1
ATOM 99 C CG2 . VAL 13 13 ? A -3.112 0.456 11.539 1 1 A VAL 0.810 1
ATOM 100 N N . GLU 14 14 ? A -4.347 -3.060 14.180 1 1 A GLU 0.780 1
ATOM 101 C CA . GLU 14 14 ? A -5.152 -3.939 14.998 1 1 A GLU 0.780 1
ATOM 102 C C . GLU 14 14 ? A -4.557 -4.232 16.387 1 1 A GLU 0.780 1
ATOM 103 O O . GLU 14 14 ? A -5.269 -4.389 17.373 1 1 A GLU 0.780 1
ATOM 104 C CB . GLU 14 14 ? A -5.411 -5.227 14.198 1 1 A GLU 0.780 1
ATOM 105 C CG . GLU 14 14 ? A -6.719 -5.938 14.598 1 1 A GLU 0.780 1
ATOM 106 C CD . GLU 14 14 ? A -6.772 -7.328 13.982 1 1 A GLU 0.780 1
ATOM 107 O OE1 . GLU 14 14 ? A -6.768 -7.416 12.724 1 1 A GLU 0.780 1
ATOM 108 O OE2 . GLU 14 14 ? A -6.805 -8.313 14.763 1 1 A GLU 0.780 1
ATOM 109 N N . HIS 15 15 ? A -3.207 -4.309 16.486 1 1 A HIS 0.760 1
ATOM 110 C CA . HIS 15 15 ? A -2.470 -4.555 17.718 1 1 A HIS 0.760 1
ATOM 111 C C . HIS 15 15 ? A -2.283 -3.331 18.598 1 1 A HIS 0.760 1
ATOM 112 O O . HIS 15 15 ? A -2.554 -3.368 19.793 1 1 A HIS 0.760 1
ATOM 113 C CB . HIS 15 15 ? A -1.058 -5.110 17.408 1 1 A HIS 0.760 1
ATOM 114 C CG . HIS 15 15 ? A -1.092 -6.526 16.936 1 1 A HIS 0.760 1
ATOM 115 N ND1 . HIS 15 15 ? A -0.084 -7.365 17.378 1 1 A HIS 0.760 1
ATOM 116 C CD2 . HIS 15 15 ? A -1.984 -7.221 16.190 1 1 A HIS 0.760 1
ATOM 117 C CE1 . HIS 15 15 ? A -0.389 -8.545 16.901 1 1 A HIS 0.760 1
ATOM 118 N NE2 . HIS 15 15 ? A -1.533 -8.525 16.168 1 1 A HIS 0.760 1
ATOM 119 N N . LEU 16 16 ? A -1.802 -2.203 18.030 1 1 A LEU 0.780 1
ATOM 120 C CA . LEU 16 16 ? A -1.639 -0.952 18.747 1 1 A LEU 0.780 1
ATOM 121 C C . LEU 16 16 ? A -2.951 -0.208 18.934 1 1 A LEU 0.780 1
ATOM 122 O O . LEU 16 16 ? A -3.133 0.486 19.926 1 1 A LEU 0.780 1
ATOM 123 C CB . LEU 16 16 ? A -0.621 -0.001 18.055 1 1 A LEU 0.780 1
ATOM 124 C CG . LEU 16 16 ? A 0.813 -0.559 17.908 1 1 A LEU 0.780 1
ATOM 125 C CD1 . LEU 16 16 ? A 1.727 0.517 17.295 1 1 A LEU 0.780 1
ATOM 126 C CD2 . LEU 16 16 ? A 1.413 -1.043 19.242 1 1 A LEU 0.780 1
ATOM 127 N N . GLY 17 17 ? A -3.899 -0.319 17.974 1 1 A GLY 0.790 1
ATOM 128 C CA . GLY 17 17 ? A -5.186 0.366 18.055 1 1 A GLY 0.790 1
ATOM 129 C C . GLY 17 17 ? A -5.154 1.811 17.614 1 1 A GLY 0.790 1
ATOM 130 O O . GLY 17 17 ? A -5.978 2.615 18.032 1 1 A GLY 0.790 1
ATOM 131 N N . VAL 18 18 ? A -4.177 2.186 16.761 1 1 A VAL 0.790 1
ATOM 132 C CA . VAL 18 18 ? A -3.927 3.564 16.349 1 1 A VAL 0.790 1
ATOM 133 C C . VAL 18 18 ? A -4.571 3.835 14.986 1 1 A VAL 0.790 1
ATOM 134 O O . VAL 18 18 ? A -5.351 3.070 14.478 1 1 A VAL 0.790 1
ATOM 135 C CB . VAL 18 18 ? A -2.428 3.926 16.375 1 1 A VAL 0.790 1
ATOM 136 C CG1 . VAL 18 18 ? A -1.920 3.743 17.827 1 1 A VAL 0.790 1
ATOM 137 C CG2 . VAL 18 18 ? A -1.565 3.119 15.366 1 1 A VAL 0.790 1
ATOM 138 N N . GLU 19 19 ? A -4.273 4.984 14.344 1 1 A GLU 0.740 1
ATOM 139 C CA . GLU 19 19 ? A -4.681 5.229 12.972 1 1 A GLU 0.740 1
ATOM 140 C C . GLU 19 19 ? A -3.712 4.671 11.944 1 1 A GLU 0.740 1
ATOM 141 O O . GLU 19 19 ? A -2.496 4.735 12.123 1 1 A GLU 0.740 1
ATOM 142 C CB . GLU 19 19 ? A -4.755 6.741 12.722 1 1 A GLU 0.740 1
ATOM 143 C CG . GLU 19 19 ? A -5.829 7.413 13.596 1 1 A GLU 0.740 1
ATOM 144 C CD . GLU 19 19 ? A -5.700 8.927 13.581 1 1 A GLU 0.740 1
ATOM 145 O OE1 . GLU 19 19 ? A -4.594 9.425 13.262 1 1 A GLU 0.740 1
ATOM 146 O OE2 . GLU 19 19 ? A -6.649 9.596 14.046 1 1 A GLU 0.740 1
ATOM 147 N N . SER 20 20 ? A -4.250 4.150 10.816 1 1 A SER 0.760 1
ATOM 148 C CA . SER 20 20 ? A -3.510 3.632 9.665 1 1 A SER 0.760 1
ATOM 149 C C . SER 20 20 ? A -2.669 4.658 8.930 1 1 A SER 0.760 1
ATOM 150 O O . SER 20 20 ? A -1.548 4.357 8.547 1 1 A SER 0.760 1
ATOM 151 C CB . SER 20 20 ? A -4.380 2.963 8.566 1 1 A SER 0.760 1
ATOM 152 O OG . SER 20 20 ? A -5.283 2.006 9.109 1 1 A SER 0.760 1
ATOM 153 N N . ASP 21 21 ? A -3.181 5.899 8.734 1 1 A ASP 0.740 1
ATOM 154 C CA . ASP 21 21 ? A -2.508 7.010 8.074 1 1 A ASP 0.740 1
ATOM 155 C C . ASP 21 21 ? A -1.197 7.429 8.728 1 1 A ASP 0.740 1
ATOM 156 O O . ASP 21 21 ? A -0.246 7.824 8.071 1 1 A ASP 0.740 1
ATOM 157 C CB . ASP 21 21 ? A -3.451 8.240 8.049 1 1 A ASP 0.740 1
ATOM 158 C CG . ASP 21 21 ? A -4.508 8.061 6.976 1 1 A ASP 0.740 1
ATOM 159 O OD1 . ASP 21 21 ? A -4.154 7.544 5.888 1 1 A ASP 0.740 1
ATOM 160 O OD2 . ASP 21 21 ? A -5.677 8.431 7.241 1 1 A ASP 0.740 1
ATOM 161 N N . LYS 22 22 ? A -1.128 7.330 10.071 1 1 A LYS 0.690 1
ATOM 162 C CA . LYS 22 22 ? A 0.074 7.581 10.843 1 1 A LYS 0.690 1
ATOM 163 C C . LYS 22 22 ? A 1.172 6.540 10.689 1 1 A LYS 0.690 1
ATOM 164 O O . LYS 22 22 ? A 2.331 6.812 10.983 1 1 A LYS 0.690 1
ATOM 165 C CB . LYS 22 22 ? A -0.262 7.596 12.350 1 1 A LYS 0.690 1
ATOM 166 C CG . LYS 22 22 ? A -1.252 8.701 12.718 1 1 A LYS 0.690 1
ATOM 167 C CD . LYS 22 22 ? A -1.514 8.787 14.228 1 1 A LYS 0.690 1
ATOM 168 C CE . LYS 22 22 ? A -2.111 10.150 14.595 1 1 A LYS 0.690 1
ATOM 169 N NZ . LYS 22 22 ? A -2.925 10.058 15.820 1 1 A LYS 0.690 1
ATOM 170 N N . VAL 23 23 ? A 0.828 5.314 10.250 1 1 A VAL 0.760 1
ATOM 171 C CA . VAL 23 23 ? A 1.761 4.231 10.008 1 1 A VAL 0.760 1
ATOM 172 C C . VAL 23 23 ? A 2.378 4.423 8.631 1 1 A VAL 0.760 1
ATOM 173 O O . VAL 23 23 ? A 1.991 3.784 7.647 1 1 A VAL 0.760 1
ATOM 174 C CB . VAL 23 23 ? A 1.078 2.866 10.065 1 1 A VAL 0.760 1
ATOM 175 C CG1 . VAL 23 23 ? A 2.133 1.742 9.953 1 1 A VAL 0.760 1
ATOM 176 C CG2 . VAL 23 23 ? A 0.209 2.692 11.333 1 1 A VAL 0.760 1
ATOM 177 N N . THR 24 24 ? A 3.340 5.344 8.515 1 1 A THR 0.750 1
ATOM 178 C CA . THR 24 24 ? A 4.061 5.633 7.297 1 1 A THR 0.750 1
ATOM 179 C C . THR 24 24 ? A 5.376 4.859 7.327 1 1 A THR 0.750 1
ATOM 180 O O . THR 24 24 ? A 5.644 4.115 8.263 1 1 A THR 0.750 1
ATOM 181 C CB . THR 24 24 ? A 4.144 7.141 7.018 1 1 A THR 0.750 1
ATOM 182 O OG1 . THR 24 24 ? A 4.828 7.855 8.026 1 1 A THR 0.750 1
ATOM 183 C CG2 . THR 24 24 ? A 2.725 7.740 7.034 1 1 A THR 0.750 1
ATOM 184 N N . GLN 25 25 ? A 6.177 4.957 6.251 1 1 A GLN 0.580 1
ATOM 185 C CA . GLN 25 25 ? A 7.548 4.496 6.162 1 1 A GLN 0.580 1
ATOM 186 C C . GLN 25 25 ? A 8.539 5.287 7.050 1 1 A GLN 0.580 1
ATOM 187 O O . GLN 25 25 ? A 8.349 6.504 7.295 1 1 A GLN 0.580 1
ATOM 188 C CB . GLN 25 25 ? A 7.997 4.620 4.675 1 1 A GLN 0.580 1
ATOM 189 C CG . GLN 25 25 ? A 9.393 4.016 4.373 1 1 A GLN 0.580 1
ATOM 190 C CD . GLN 25 25 ? A 9.843 4.141 2.912 1 1 A GLN 0.580 1
ATOM 191 O OE1 . GLN 25 25 ? A 9.326 4.870 2.081 1 1 A GLN 0.580 1
ATOM 192 N NE2 . GLN 25 25 ? A 10.917 3.367 2.589 1 1 A GLN 0.580 1
ATOM 193 O OXT . GLN 25 25 ? A 9.546 4.672 7.490 1 1 A GLN 0.580 1
#
#
loop_
_atom_type.symbol
C
N
O
S
#
#
loop_
_ma_qa_metric.id
_ma_qa_metric.name
_ma_qa_metric.description
_ma_qa_metric.type
_ma_qa_metric.mode
_ma_qa_metric.type_other_details
_ma_qa_metric.software_group_id
1 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].'
'pLDDT all-atom in [0,1]' local . 5
2 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].'
'pLDDT all-atom in [0,1]' global . 5
3 GMQE
'Global Model Quality Estimate of the model accuracy, calculated by SWISS-MODEL.'
'normalized score' global . 6
#
#
loop_
_ma_qa_metric_global.ordinal_id
_ma_qa_metric_global.model_id
_ma_qa_metric_global.metric_id
_ma_qa_metric_global.metric_value
1 1 2 0.760
2 1 3 0.812
#
#
loop_
_ma_qa_metric_local.ordinal_id
_ma_qa_metric_local.model_id
_ma_qa_metric_local.label_asym_id
_ma_qa_metric_local.label_seq_id
_ma_qa_metric_local.label_comp_id
_ma_qa_metric_local.metric_id
_ma_qa_metric_local.metric_value
1 1 A 1 MET 1 0.640
2 1 A 2 SER 1 0.700
3 1 A 3 ASP 1 0.800
4 1 A 4 THR 1 0.820
5 1 A 5 ALA 1 0.810
6 1 A 6 THR 1 0.790
7 1 A 7 ARG 1 0.730
8 1 A 8 VAL 1 0.820
9 1 A 9 GLN 1 0.770
10 1 A 10 LYS 1 0.770
11 1 A 11 ILE 1 0.810
12 1 A 12 VAL 1 0.820
13 1 A 13 VAL 1 0.810
14 1 A 14 GLU 1 0.780
15 1 A 15 HIS 1 0.760
16 1 A 16 LEU 1 0.780
17 1 A 17 GLY 1 0.790
18 1 A 18 VAL 1 0.790
19 1 A 19 GLU 1 0.740
20 1 A 20 SER 1 0.760
21 1 A 21 ASP 1 0.740
22 1 A 22 LYS 1 0.690
23 1 A 23 VAL 1 0.760
24 1 A 24 THR 1 0.750
25 1 A 25 GLN 1 0.580
#
#
loop_
_pdbx_data_usage.id
_pdbx_data_usage.type
_pdbx_data_usage.details
_pdbx_data_usage.url
1 license
;This SWISS-MODEL protein model is copyright.
It is produced by the SWISS-MODEL server, developed by the Computational
Structural Biology Group at the SIB Swiss Institute of Bioinformatics at the
Biozentrum, University of Basel (https://swissmodel.expasy.org). This
model is licensed under the CC BY-SA 4.0 Creative Commons
Attribution-ShareAlike 4.0 International License
(https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
can copy and redistribute the model in any medium or format,
transform and build upon the model for any purpose, even
commercially, under the following terms:
Attribution - You must give appropriate credit, provide a link to
the license, and indicate if changes were made. You may do so in any
reasonable manner, but not in any way that suggests the licensor
endorses you or your use. When you publish, patent or distribute
results that were fully or partially based on the model, please cite
the corresponding papers mentioned under JRNL.
ShareAlike - If you remix, transform, or build upon the material,
you must distribute your contributions under the same license as the
original.
No additional restrictions - you may not apply legal terms or
technological measures that legally restrict others from doing
anything the license permits.
Find a human-readable summary of (and not a substitute for) the
CC BY-SA 4.0 license at this link:
https://creativecommons.org/licenses/by-sa/4.0/
;
https://creativecommons.org/licenses/by-sa/4.0/legalcode
2 disclaimer
;The SWISS-MODEL SERVER produces theoretical models for
proteins. The results of any theoretical modelling procedure is
NON-EXPERIMENTAL and MUST be considered with care. These models may
contain significant errors. This is especially true for automated
modeling since there is no human intervention during model
building. Please read the header section and the logfile carefully
to know what templates and alignments were used during the model
building process. All information by the SWISS-MODEL SERVER is
provided "AS-IS", without any warranty, expressed or implied.
;
https://swissmodel.expasy.org/docs/terms_of_use#disclaimer
#