data_SMR-f963e06024c88d1f5d03cce62cab759d_1 _entry.id SMR-f963e06024c88d1f5d03cce62cab759d_1 _struct.entry_id SMR-f963e06024c88d1f5d03cce62cab759d_1 _struct.pdbx_model_details ;This model was generated unsupervised by the SWISS-MODEL homology-modelling pipeline for the SWISS-MODEL Repository, a database of annotated 3D protein structure models. The modelled monomer covers following UniProtKB entries: - A0A081PMH0/ A0A081PMH0_STRMT, Large ribosomal subunit protein bL36 - A0A098Z6X1/ A0A098Z6X1_STREE, Large ribosomal subunit protein bL36 - A0A0A7T2G6/ A0A0A7T2G6_LACLL, Large ribosomal subunit protein bL36 - A0A0F2CRB0/ A0A0F2CRB0_STRCR, Large ribosomal subunit protein bL36 - A0A0F2CVM6/ A0A0F2CVM6_STROR, Large ribosomal subunit protein bL36 - A0A0F2E799/ A0A0F2E799_STROR, Large ribosomal subunit protein bL36 - A0A0F3HB43/ A0A0F3HB43_STRPA, Large ribosomal subunit protein bL36 - A0A0F3HPM6/ A0A0F3HPM6_9STRE, Large ribosomal subunit protein bL36 - A0A0H3MT07/ A0A0H3MT07_STRS4, Large ribosomal subunit protein bL36 - A0A0K2E3D6/ A0A0K2E3D6_STRSU, Large ribosomal subunit protein bL36 - A0A0X8JZN8/ A0A0X8JZN8_9STRE, Large ribosomal subunit protein bL36 - A0A139NFF2/ A0A139NFF2_9STRE, Large ribosomal subunit protein bL36 - A0A178K3N5/ A0A178K3N5_9STRE, Large ribosomal subunit protein bL36 - A0A1B1IEL9/ A0A1B1IEL9_9STRE, Large ribosomal subunit protein bL36 - A0A1E1GCV2/ A0A1E1GCV2_9STRE, Large ribosomal subunit protein bL36 - A0A1E8U0B9/ A0A1E8U0B9_9STRE, Large ribosomal subunit protein bL36 - A0A1E9A9F3/ A0A1E9A9F3_9STRE, Large ribosomal subunit protein bL36 - A0A1E9B485/ A0A1E9B485_9STRE, Large ribosomal subunit protein bL36 - A0A1E9G3N7/ A0A1E9G3N7_9STRE, Large ribosomal subunit protein bL36 - A0A1E9GFE1/ A0A1E9GFE1_9STRE, Large ribosomal subunit protein bL36 - A0A1F0A2P4/ A0A1F0A2P4_9STRE, Large ribosomal subunit protein bL36 - A0A1F0B3P0/ A0A1F0B3P0_9STRE, Large ribosomal subunit protein bL36 - A0A1F0BJ54/ A0A1F0BJ54_9STRE, Large ribosomal subunit protein bL36 - A0A1F0BS89/ A0A1F0BS89_9STRE, Large ribosomal subunit protein bL36 - A0A1F0NIB2/ A0A1F0NIB2_9STRE, Large ribosomal subunit protein bL36 - A0A1F0TA11/ A0A1F0TA11_9STRE, Large ribosomal subunit protein bL36 - A0A1H0SC76/ A0A1H0SC76_9STRE, Large ribosomal subunit protein bL36 - A0A1L8Q3X5/ A0A1L8Q3X5_STROR, Large ribosomal subunit protein bL36 - A0A1Q8E5M4/ A0A1Q8E5M4_9STRE, Large ribosomal subunit protein bL36 - A0A1Q8EBS6/ A0A1Q8EBS6_STRAI, Large ribosomal subunit protein bL36 - A0A1S1CZQ1/ A0A1S1CZQ1_9STRE, Large ribosomal subunit protein bL36 - A0A1S1GZ97/ A0A1S1GZ97_9STRE, Large ribosomal subunit protein bL36 - A0A1S9ZTV2/ A0A1S9ZTV2_9STRE, Large ribosomal subunit protein bL36 - A0A1X1IYL8/ A0A1X1IYL8_STROR, Large ribosomal subunit protein bL36 - A0A231W1U0/ A0A231W1U0_9STRE, Large ribosomal subunit protein bL36 - A0A239SXC7/ A0A239SXC7_9STRE, Large ribosomal subunit protein bL36 - A0A269YVI5/ A0A269YVI5_9LACT, Large ribosomal subunit protein bL36 - A0A2I1UUY7/ A0A2I1UUY7_STRAP, Large ribosomal subunit protein bL36 - A0A2J9EW94/ A0A2J9EW94_9STRE, Large ribosomal subunit protein bL36 - A0A2N6PRZ2/ A0A2N6PRZ2_9STRE, Large ribosomal subunit protein bL36 - A0A2X3YS89/ A0A2X3YS89_STRSA, Large ribosomal subunit protein bL36 - A0A354QR81/ A0A354QR81_STRSP, Large ribosomal subunit protein bL36 - A0A371QE74/ A0A371QE74_9STRE, Large ribosomal subunit protein bL36 - A0A380JL73/ A0A380JL73_STRCV, Large ribosomal subunit protein bL36 - A0A380L6H5/ A0A380L6H5_9STRE, Large ribosomal subunit protein bL36 - A0A380M6X0/ A0A380M6X0_9STRE, Large ribosomal subunit protein bL36 - A0A387AY47/ A0A387AY47_9STRE, Large ribosomal subunit protein bL36 - A0A3A5Q0B5/ A0A3A5Q0B5_9STRE, Large ribosomal subunit protein bL36 - A0A3B0BFT2/ A0A3B0BFT2_9STRE, Large ribosomal subunit protein bL36 - A0A3P1V999/ A0A3P1V999_9STRE, Large ribosomal subunit protein bL36 - A0A3P1VKX4/ A0A3P1VKX4_9STRE, Large ribosomal subunit protein bL36 - A0A3R8LSI2/ A0A3R8LSI2_9STRE, Large ribosomal subunit protein bL36 - A0A3R9LRQ4/ A0A3R9LRQ4_9STRE, Large ribosomal subunit protein bL36 - A0A3R9N9U1/ A0A3R9N9U1_9STRE, Large ribosomal subunit protein bL36 - A0A3S9MTC9/ A0A3S9MTC9_9STRE, Large ribosomal subunit protein bL36 - A0A4Q8L287/ A0A4Q8L287_9STRE, Large ribosomal subunit protein bL36 - A0A4R0QE92/ A0A4R0QE92_9STRE, Large ribosomal subunit protein bL36 - A0A4Y9JHT8/ A0A4Y9JHT8_9STRE, Large ribosomal subunit protein bL36 - A0A4Z1DVZ6/ A0A4Z1DVZ6_9STRE, Large ribosomal subunit protein bL36 - A0A501PE39/ A0A501PE39_9STRE, Large ribosomal subunit protein bL36 - A0A501VXD6/ A0A501VXD6_9STRE, Large ribosomal subunit protein bL36 - A0A5B7Y877/ A0A5B7Y877_9STRE, Large ribosomal subunit protein bL36 - A0A5D4FU11/ A0A5D4FU11_LACLL, Large ribosomal subunit protein bL36 - A0A5J6LL06/ A0A5J6LL06_9STRE, Large ribosomal subunit protein bL36 - A0A5M9QA14/ A0A5M9QA14_LACLH, Large ribosomal subunit protein bL36 - A0A6B0C1K9/ A0A6B0C1K9_STAAU, Large ribosomal subunit protein bL36 - A0A6D1TIA9/ A0A6D1TIA9_LACLC, Large ribosomal subunit protein bL36 - A0A6I3JA06/ A0A6I3JA06_9STRE, Large ribosomal subunit protein bL36 - A0A6I4RJZ1/ A0A6I4RJZ1_9STRE, Large ribosomal subunit protein bL36 - A0A7G9AXX3/ A0A7G9AXX3_9STRE, Large ribosomal subunit protein bL36 - A0A7H8ZA40/ A0A7H8ZA40_9STRE, Large ribosomal subunit protein bL36 - A0A7L8W328/ A0A7L8W328_9STRE, Large ribosomal subunit protein bL36 - A0A7X2VKT8/ A0A7X2VKT8_9STRE, Large ribosomal subunit protein bL36 - A0A7X3KC05/ A0A7X3KC05_9STRE, Large ribosomal subunit protein bL36 - A0A7X6MW54/ A0A7X6MW54_9STRE, Large ribosomal subunit protein bL36 - A0A7X9MFL5/ A0A7X9MFL5_9STRE, Large ribosomal subunit protein bL36 - A0A9X0WP03/ A0A9X0WP03_9STRE, Large ribosomal subunit protein bL36 - A0AA49EYH9/ A0AA49EYH9_9LACT, Large ribosomal subunit protein bL36 - A0AA96NSG2/ A0AA96NSG2_9STRE, Large ribosomal subunit protein bL36 - A0AA96S445/ A0AA96S445_9STRE, Large ribosomal subunit protein bL36 - A0AA96VLI0/ A0AA96VLI0_9STRE, Large ribosomal subunit protein bL36 - A0AA96ZZ32/ A0AA96ZZ32_9STRE, Large ribosomal subunit protein bL36 - A0AA97A2W6/ A0AA97A2W6_9STRE, Large ribosomal subunit protein bL36 - A0AAD2T8T9/ A0AAD2T8T9_STRAP, Large ribosomal subunit protein bL36 - A0AAE8FYL8/ A0AAE8FYL8_STRIT, Large ribosomal subunit protein bL36 - A0AAI9J8Q5/ A0AAI9J8Q5_9STRE, Large ribosomal subunit protein bL36 - A0AAJ2T8W5/ A0AAJ2T8W5_9STRE, Large ribosomal subunit protein bL36 - A0AAQ3A6N9/ A0AAQ3A6N9_STRGN, Large ribosomal subunit protein bL36 - A0AAU7PYI7/ A0AAU7PYI7_9STRE, Large ribosomal subunit protein bL36 - A0AAV3EHD7/ A0AAV3EHD7_STRCR, Large ribosomal subunit protein bL36 - A0AAW7NZ24/ A0AAW7NZ24_9STRE, Large ribosomal subunit protein bL36 - A0AAW7P1A0/ A0AAW7P1A0_9STRE, Large ribosomal subunit protein bL36 - A0AAW7P8H7/ A0AAW7P8H7_9STRE, Large ribosomal subunit protein bL36 - A0AAW7W467/ A0AAW7W467_9STRE, Large ribosomal subunit protein bL36 - A0AAX3TIV8/ A0AAX3TIV8_9STRE, Large ribosomal subunit protein bL36 - A0AB36JMW4/ A0AB36JMW4_9STRE, Large ribosomal subunit protein bL36 - A0AB39LC39/ A0AB39LC39_9STRE, Large ribosomal subunit protein bL36 - A2RNN0/ RL36_LACLM, Large ribosomal subunit protein bL36 - A3CK87/ RL36_STRSV, Large ribosomal subunit protein bL36 - A8AZK2/ RL36_STRGC, Large ribosomal subunit protein bL36 - B1I8M1/ RL36_STRPI, Large ribosomal subunit protein bL36 - C1CAN5/ RL36_STRP7, Large ribosomal subunit protein bL36 - C1CC29/ RL36_STRZJ, Large ribosomal subunit protein bL36 - C1CIC0/ RL36_STRZP, Large ribosomal subunit protein bL36 - C1CPB1/ RL36_STRZT, Large ribosomal subunit protein bL36 - D2EN36/ D2EN36_9STRE, Large ribosomal subunit protein bL36 - D3HB68/ D3HB68_STRM6, Large ribosomal subunit protein bL36 - E1LMU0/ E1LMU0_STRMT, Large ribosomal subunit protein bL36 - E3CBZ2/ E3CBZ2_STRPA, Large ribosomal subunit protein bL36 - E6J2R9/ E6J2R9_STRAP, Large ribosomal subunit protein bL36 - F2QFI3/ F2QFI3_STROU, Large ribosomal subunit protein bL36 - F5VWU8/ F5VWU8_STROR, Large ribosomal subunit protein bL36 - F5W1R2/ F5W1R2_9STRE, Large ribosomal subunit protein bL36 - F9HBJ6/ F9HBJ6_STRMT, Large ribosomal subunit protein bL36 - F9HEW6/ F9HEW6_9STRE, Large ribosomal subunit protein bL36 - F9HKM2/ F9HKM2_STRMT, Large ribosomal subunit protein bL36 - F9P2Q1/ F9P2Q1_STROR, Large ribosomal subunit protein bL36 - I0Q4U5/ I0Q4U5_STROR, Large ribosomal subunit protein bL36 - I0SIG8/ I0SIG8_STRAP, Large ribosomal subunit protein bL36 - I0SR83/ I0SR83_STRMT, Large ribosomal subunit protein bL36 - I2J509/ I2J509_9STRE, Large ribosomal subunit protein bL36 - I2J9W8/ I2J9W8_9STRE, Large ribosomal subunit protein bL36 - J1SEE1/ J1SEE1_9STRE, Large ribosomal subunit protein bL36 - J4K7B2/ J4K7B2_STROR, Large ribosomal subunit protein bL36 - J4XHW7/ J4XHW7_9STRE, Large ribosomal subunit protein bL36 - K0Z1V3/ K0Z1V3_9STRE, Large ribosomal subunit protein bL36 - K1A5J8/ K1A5J8_9STRE, Large ribosomal subunit protein bL36 - K2G061/ K2G061_9BACT, Large ribosomal subunit protein bL36 - K8MH16/ K8MH16_9STRE, Large ribosomal subunit protein bL36 - P0A493/ RL36_LACLA, Large ribosomal subunit protein bL36 - P0A494/ RL36_LACLC, Large ribosomal subunit protein bL36 - P0A495/ RL36_STRPN, Large ribosomal subunit protein bL36 - P0A496/ RL36_STRR6, Large ribosomal subunit protein bL36 - Q02W48/ RL36_LACLS, Large ribosomal subunit protein bL36 - R0LIU9/ R0LIU9_STRMT, Large ribosomal subunit protein bL36 - R0NSJ0/ R0NSJ0_STRMT, Large ribosomal subunit protein bL36 - S3ABA8/ S3ABA8_9STRE, Large ribosomal subunit protein bL36 - S6EW07/ S6EW07_LACLL, Large ribosomal subunit protein bL36 - T1ZGJ5/ T1ZGJ5_STRIT, Large ribosomal subunit protein bL36 - V8B7X6/ V8B7X6_STRPA, Large ribosomal subunit protein bL36 - W1TLS5/ W1TLS5_STRAP, Large ribosomal subunit protein bL36 - X8K607/ X8K607_9STRE, Large ribosomal subunit protein bL36 Estimated model accuracy of this model is 0.837, calculated by SWISS-MODEL as Global Model Quality Estimate (GMQE). ; _struct.pdbx_structure_determination_methodology computational _struct.title 'Model for UniProtKB entries A0A081PMH0, A0A098Z6X1, A0A0A7T2G6, A0A0F2CRB0, A0A0F2CVM6, A0A0F2E799, A0A0F3HB43, A0A0F3HPM6, A0A0H3MT07, A0A0K2E3D6, A0A0X8JZN8, A0A139NFF2, A0A178K3N5, A0A1B1IEL9, A0A1E1GCV2, A0A1E8U0B9, A0A1E9A9F3, A0A1E9B485, A0A1E9G3N7, A0A1E9GFE1, A0A1F0A2P4, A0A1F0B3P0, A0A1F0BJ54, A0A1F0BS89, A0A1F0NIB2, A0A1F0TA11, A0A1H0SC76, A0A1L8Q3X5, A0A1Q8E5M4, A0A1Q8EBS6, A0A1S1CZQ1, A0A1S1GZ97, A0A1S9ZTV2, A0A1X1IYL8, A0A231W1U0, A0A239SXC7, A0A269YVI5, A0A2I1UUY7, A0A2J9EW94, A0A2N6PRZ2, A0A2X3YS89, A0A354QR81, A0A371QE74, A0A380JL73, A0A380L6H5, A0A380M6X0, A0A387AY47, A0A3A5Q0B5, A0A3B0BFT2, A0A3P1V999, A0A3P1VKX4, A0A3R8LSI2, A0A3R9LRQ4, A0A3R9N9U1, A0A3S9MTC9, A0A4Q8L287, A0A4R0QE92, A0A4Y9JHT8, A0A4Z1DVZ6, A0A501PE39, A0A501VXD6, A0A5B7Y877, A0A5D4FU11, A0A5J6LL06, A0A5M9QA14, A0A6B0C1K9, A0A6D1TIA9, A0A6I3JA06, A0A6I4RJZ1, A0A7G9AXX3, A0A7H8ZA40, A0A7L8W328, A0A7X2VKT8, A0A7X3KC05, A0A7X6MW54, A0A7X9MFL5, A0A9X0WP03, A0AA49EYH9, A0AA96NSG2, A0AA96S445, A0AA96VLI0, A0AA96ZZ32, A0AA97A2W6, A0AAD2T8T9, A0AAE8FYL8, A0AAI9J8Q5, A0AAJ2T8W5, A0AAQ3A6N9, A0AAU7PYI7, A0AAV3EHD7, A0AAW7NZ24, A0AAW7P1A0, A0AAW7P8H7, A0AAW7W467, A0AAX3TIV8, A0AB36JMW4, A0AB39LC39, A2RNN0, A3CK87, A8AZK2, B1I8M1, C1CAN5, C1CC29, C1CIC0, C1CPB1, D2EN36, D3HB68, E1LMU0, E3CBZ2, E6J2R9, F2QFI3, F5VWU8, F5W1R2, F9HBJ6, F9HEW6, F9HKM2, F9P2Q1, I0Q4U5, I0SIG8, I0SR83, I2J509, I2J9W8, J1SEE1, J4K7B2, J4XHW7, K0Z1V3, K1A5J8, K2G061, K8MH16, P0A493, P0A494, P0A495, P0A496, Q02W48, R0LIU9, R0NSJ0, S3ABA8, S6EW07, T1ZGJ5, V8B7X6, W1TLS5, X8K607' _audit_conform.dict_location https://raw.githubusercontent.com/ihmwg/ModelCIF/80e1e22/dist/mmcif_ma.dic _audit_conform.dict_name mmcif_ma.dic _audit_conform.dict_version 1.4.7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'The SWISS-MODEL Repository - new features and functionality' 'Nucleic Acids Res.' 45 D313 D319 2017 27899672 10.1093/nar/gkw1132 2 'SWISS-MODEL: homology modelling of protein structures and complexes' 'Nucleic Acids Res.' 46 W296 W303 2018 29788355 10.1093/nar/gky427 3 'ProMod3 - A versatile homology modelling toolbox' 'PLoS Comput. Biol.' 17(1) 1 18 2021 33507980 10.1371/journal.pcbi.1008667 4 'QMEANDisCo - distance constraints applied on model quality estimation' Bioinformatics 36 1765 1771 2020 31697312 10.1093/bioinformatics/btz828 5 'OpenStructure: an integrated software framework for computational structural biology' 'Acta Crystallogr., Sect. D: Biol. Crystallogr.' 69 701 709 2013 23633579 10.1107/S0907444913007051 6 'BLAST+: architecture and applications' 'BMC Bioinf.' 10 421 . 2009 20003500 10.1186/1471-2105-10-421 7 'HH-suite3 for fast remote homology detection and deep protein annotation' 'BMC Bioinf.' 20 473 . 2019 31521110 10.1186/s12859-019-3019-7 # # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Bienert, S.' 1 primary 'Waterhouse, A.' 2 primary 'de Beer, T.A.P.' 3 primary 'Tauriello, G.' 4 primary 'Studer, G.' 5 primary 'Bordoli, L.' 6 primary 'Schwede, T.' 7 2 'Waterhouse, A.' 8 2 'Bertoni, M.' 9 2 'Bienert, S.' 10 2 'Studer, G.' 11 2 'Tauriello, G.' 12 2 'Gumienny, R.' 13 2 'Heer, F.T.' 14 2 'de Beer, T.A.P.' 15 2 'Rempfer, C.' 16 2 'Bordoli, L.' 17 2 'Lepore, R.' 18 2 'Schwede, T.' 19 3 'Studer, G.' 20 3 'Tauriello, G.' 21 3 'Bienert, S.' 22 3 'Biasini, M.' 23 3 'Johner, N.' 24 3 'Schwede, T.' 25 4 'Studer, G.' 26 4 'Rempfer, C.' 27 4 'Waterhouse, A.M.' 28 4 'Gumienny, R.' 29 4 'Haas, J.' 30 4 'Schwede, T.' 31 5 'Biasini, M.' 32 5 'Schmidt, T.' 33 5 'Bienert, S.' 34 5 'Mariani, V.' 35 5 'Studer, G.' 36 5 'Haas, J.' 37 5 'Johner, N.' 38 5 'Schenk, A.D.' 39 5 'Philippsen, A.' 40 5 'Schwede, T.' 41 6 'Camacho, C.' 42 6 'Coulouris, G.' 43 6 'Avagyan, V.' 44 6 'Ma, N.' 45 6 'Papadopoulos, J.' 46 6 'Bealer, K.' 47 6 'Madden, T.L.' 48 7 'Steinegger, M.' 49 7 'Meier, M.' 50 7 'Mirdita, M.' 51 7 'Vohringer, H.' 52 7 'Haunsberger, S.J.' 53 7 'Soding, J.' 54 # # loop_ _software.pdbx_ordinal _software.name _software.classification _software.description _software.version _software.type _software.location _software.citation_id 1 SWISS-MODEL 'model building' 'Homology modelling web service' 2025-08.5 package https://swissmodel.expasy.org 2 2 ProMod3 'model building' 'Modular homology modelling engine' 3.6.0 library https://git.scicore.unibas.ch/schwede/ProMod3 3 3 QMEAN 'model building' 'QMEAN - Qualitative Model Energy ANalysis' 4.5.0 library https://git.scicore.unibas.ch/schwede/QMEAN 4 4 OpenStructure 'data processing' 'Open-Source Computational Structural Biology Framework' 2.11.1 package https://openstructure.org/ 5 5 BLAST 'data collection' . 2.14.1 package https://blast.ncbi.nlm.nih.gov 6 6 HH-suite 'data collection' 'HH-suite3 for sensitive sequence searching' 3.2.0 package https://github.com/soedinglab/hh-suite 7 # # loop_ _ma_software_group.ordinal_id _ma_software_group.group_id _ma_software_group.software_id _ma_software_group.parameter_group_id 1 1 6 . 2 2 1 . 3 2 4 . 4 2 5 . 5 2 6 . 6 3 1 . 7 3 4 . 8 4 1 . 9 4 2 . 10 4 4 . 11 5 3 . 12 6 1 . 13 6 3 . 14 6 4 . # # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bienert, S.' 1 'Waterhouse, A.' 2 'de Beer, T.A.P.' 3 'Tauriello, G.' 4 'Studer, G.' 5 'Bordoli, L.' 6 'Schwede, T.' 7 # # loop_ _pdbx_data_usage.id _pdbx_data_usage.type _pdbx_data_usage.details _pdbx_data_usage.url _pdbx_data_usage.name 1 license ;This SWISS-MODEL protein model is copyright. It is produced by the SWISS-MODEL server, developed by the Computational Structural Biology Group at the SIB Swiss Institute of Bioinformatics at the Biozentrum, University of Basel (https://swissmodel.expasy.org). This model is licensed under the CC BY-SA 4.0 Creative Commons Attribution-ShareAlike 4.0 International License (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you can copy and redistribute the model in any medium or format, transform and build upon the model for any purpose, even commercially, under the following terms: Attribution - You must give appropriate credit, provide a link to the license, and indicate if changes were made. You may do so in any reasonable manner, but not in any way that suggests the licensor endorses you or your use. When you publish, patent or distribute results that were fully or partially based on the model, please cite the corresponding papers mentioned under JRNL. ShareAlike - If you remix, transform, or build upon the material, you must distribute your contributions under the same license as the original. No additional restrictions - you may not apply legal terms or technological measures that legally restrict others from doing anything the license permits. Find a human-readable summary of (and not a substitute for) the CC BY-SA 4.0 license at this link: https://creativecommons.org/licenses/by-sa/4.0/ ; https://creativecommons.org/licenses/by-sa/4.0/legalcode 'Attribution-ShareAlike 4.0 International' 2 disclaimer ;The SWISS-MODEL SERVER produces theoretical models for proteins. The results of any theoretical modelling procedure is NON-EXPERIMENTAL and MUST be considered with care. These models may contain significant errors. This is especially true for automated modeling since there is no human intervention during model building. Please read the header section and the logfile carefully to know what templates and alignments were used during the model building process. All information by the SWISS-MODEL SERVER is provided "AS-IS", without any warranty, expressed or implied. ; https://swissmodel.expasy.org/docs/terms_of_use#disclaimer . # # loop_ _chem_comp.id _chem_comp.type _chem_comp.name _chem_comp.formula _chem_comp.formula_weight _chem_comp.ma_provenance ALA 'L-peptide linking' ALANINE 'C3 H7 N O2' 89.094 'CCD Core' ARG 'L-peptide linking' ARGININE 'C6 H15 N4 O2 1' 175.212 'CCD Core' ASN 'L-peptide linking' ASPARAGINE 'C4 H8 N2 O3' 132.119 'CCD Core' CYS 'L-peptide linking' CYSTEINE 'C3 H7 N O2 S' 121.154 'CCD Core' GLN 'L-peptide linking' GLUTAMINE 'C5 H10 N2 O3' 146.146 'CCD Core' GLU 'L-peptide linking' 'GLUTAMIC ACID' 'C5 H9 N O4' 147.130 'CCD Core' GLY 'peptide linking' GLYCINE 'C2 H5 N O2' 75.067 'CCD Core' HIS 'L-peptide linking' HISTIDINE 'C6 H10 N3 O2 1' 156.165 'CCD Core' ILE 'L-peptide linking' ISOLEUCINE 'C6 H13 N O2' 131.175 'CCD Core' LYS 'L-peptide linking' LYSINE 'C6 H15 N2 O2 1' 147.198 'CCD Core' MET 'L-peptide linking' METHIONINE 'C5 H11 N O2 S' 149.208 'CCD Core' PRO 'L-peptide linking' PROLINE 'C5 H9 N O2' 115.132 'CCD Core' SER 'L-peptide linking' SERINE 'C3 H7 N O3' 105.093 'CCD Core' TYR 'L-peptide linking' TYROSINE 'C9 H11 N O3' 181.191 'CCD Core' VAL 'L-peptide linking' VALINE 'C5 H11 N O2' 117.148 'CCD Core' ZN non-polymer 'ZINC ION' Zn 65.380 'CCD Core' # # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.details 1 polymer man . 5099.058 1 . 2 non-polymer man 'ZINC ION' 65.380 1 . # # loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.details 1 1 UNP RL36_LACLA P0A493 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 2 1 UNP RL36_LACLC P0A494 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 3 1 UNP RL36_LACLM A2RNN0 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 4 1 UNP RL36_LACLS Q02W48 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 5 1 UNP RL36_STRGC A8AZK2 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 6 1 UNP RL36_STRP7 C1CAN5 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 7 1 UNP RL36_STRPI B1I8M1 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 8 1 UNP RL36_STRR6 P0A496 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 9 1 UNP RL36_STRSV A3CK87 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 10 1 UNP RL36_STRPN P0A495 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 11 1 UNP RL36_STRZT C1CPB1 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 12 1 UNP RL36_STRZP C1CIC0 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 13 1 UNP RL36_STRZJ C1CC29 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 14 1 UNP A0AA96S445_9STRE A0AA96S445 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 15 1 UNP A0AA49EYH9_9LACT A0AA49EYH9 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 16 1 UNP A0AA96ZZ32_9STRE A0AA96ZZ32 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 17 1 UNP A0AB39LC39_9STRE A0AB39LC39 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 18 1 UNP A0AA97A2W6_9STRE A0AA97A2W6 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 19 1 UNP A0AA96VLI0_9STRE A0AA96VLI0 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 20 1 UNP A0AAU7PYI7_9STRE A0AAU7PYI7 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 21 1 UNP A0A5D4FU11_LACLL A0A5D4FU11 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 22 1 UNP K2G061_9BACT K2G061 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 23 1 UNP A0A0F2CVM6_STROR A0A0F2CVM6 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 24 1 UNP A0A1X1IYL8_STROR A0A1X1IYL8 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 25 1 UNP A0A1Q8EBS6_STRAI A0A1Q8EBS6 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 26 1 UNP A0A1S9ZTV2_9STRE A0A1S9ZTV2 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 27 1 UNP A0A354QR81_STRSP A0A354QR81 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 28 1 UNP A0A7X3KC05_9STRE A0A7X3KC05 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 29 1 UNP A0A098Z6X1_STREE A0A098Z6X1 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 30 1 UNP A0A380M6X0_9STRE A0A380M6X0 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 31 1 UNP A0AAQ3A6N9_STRGN A0AAQ3A6N9 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 32 1 UNP A0A0K2E3D6_STRSU A0A0K2E3D6 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 33 1 UNP A0A2X3YS89_STRSA A0A2X3YS89 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 34 1 UNP A0A269YVI5_9LACT A0A269YVI5 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 35 1 UNP A0A0F2E799_STROR A0A0F2E799 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 36 1 UNP A0A081PMH0_STRMT A0A081PMH0 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 37 1 UNP A0A1Q8E5M4_9STRE A0A1Q8E5M4 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 38 1 UNP A0A0F2CRB0_STRCR A0A0F2CRB0 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 39 1 UNP A0AAW7NZ24_9STRE A0AAW7NZ24 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 40 1 UNP A0A6D1TIA9_LACLC A0A6D1TIA9 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 41 1 UNP A0A0A7T2G6_LACLL A0A0A7T2G6 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 42 1 UNP A0AAE8FYL8_STRIT A0AAE8FYL8 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 43 1 UNP A0A1L8Q3X5_STROR A0A1L8Q3X5 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 44 1 UNP A0A0F3HPM6_9STRE A0A0F3HPM6 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 45 1 UNP A0A2I1UUY7_STRAP A0A2I1UUY7 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 46 1 UNP A0A0F3HB43_STRPA A0A0F3HB43 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 47 1 UNP A0A2J9EW94_9STRE A0A2J9EW94 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 48 1 UNP E6J2R9_STRAP E6J2R9 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 49 1 UNP I0SIG8_STRAP I0SIG8 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 50 1 UNP A0A4Z1DVZ6_9STRE A0A4Z1DVZ6 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 51 1 UNP A0A0X8JZN8_9STRE A0A0X8JZN8 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 52 1 UNP A0A7H8ZA40_9STRE A0A7H8ZA40 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 53 1 UNP A0AB36JMW4_9STRE A0AB36JMW4 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 54 1 UNP A0A3P1VKX4_9STRE A0A3P1VKX4 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 55 1 UNP A0AAV3EHD7_STRCR A0AAV3EHD7 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 56 1 UNP A0AAW7P1A0_9STRE A0AAW7P1A0 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 57 1 UNP A0A1F0NIB2_9STRE A0A1F0NIB2 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 58 1 UNP A0A1F0BJ54_9STRE A0A1F0BJ54 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 59 1 UNP W1TLS5_STRAP W1TLS5 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 60 1 UNP A0A371QE74_9STRE A0A371QE74 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 61 1 UNP A0A7X2VKT8_9STRE A0A7X2VKT8 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 62 1 UNP K1A5J8_9STRE K1A5J8 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 63 1 UNP A0A5B7Y877_9STRE A0A5B7Y877 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 64 1 UNP A0A501PE39_9STRE A0A501PE39 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 65 1 UNP A0A178K3N5_9STRE A0A178K3N5 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 66 1 UNP J4XHW7_9STRE J4XHW7 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 67 1 UNP A0A3R9LRQ4_9STRE A0A3R9LRQ4 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 68 1 UNP A0A4Y9JHT8_9STRE A0A4Y9JHT8 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 69 1 UNP S6EW07_LACLL S6EW07 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 70 1 UNP A0A9X0WP03_9STRE A0A9X0WP03 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 71 1 UNP A0A7L8W328_9STRE A0A7L8W328 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 72 1 UNP F9HKM2_STRMT F9HKM2 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 73 1 UNP A0A3S9MTC9_9STRE A0A3S9MTC9 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 74 1 UNP A0A231W1U0_9STRE A0A231W1U0 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 75 1 UNP A0AAX3TIV8_9STRE A0AAX3TIV8 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 76 1 UNP A0A1F0TA11_9STRE A0A1F0TA11 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 77 1 UNP F5W1R2_9STRE F5W1R2 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 78 1 UNP A0A1E1GCV2_9STRE A0A1E1GCV2 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 79 1 UNP A0A1S1CZQ1_9STRE A0A1S1CZQ1 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 80 1 UNP J4K7B2_STROR J4K7B2 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 81 1 UNP T1ZGJ5_STRIT T1ZGJ5 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 82 1 UNP A0A2N6PRZ2_9STRE A0A2N6PRZ2 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 83 1 UNP A0A3A5Q0B5_9STRE A0A3A5Q0B5 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 84 1 UNP A0A5J6LL06_9STRE A0A5J6LL06 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 85 1 UNP F9HBJ6_STRMT F9HBJ6 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 86 1 UNP A0A7X6MW54_9STRE A0A7X6MW54 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 87 1 UNP A0A4Q8L287_9STRE A0A4Q8L287 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 88 1 UNP R0NSJ0_STRMT R0NSJ0 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 89 1 UNP I0SR83_STRMT I0SR83 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 90 1 UNP A0A387AY47_9STRE A0A387AY47 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 91 1 UNP A0AAW7W467_9STRE A0AAW7W467 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 92 1 UNP A0AAI9J8Q5_9STRE A0AAI9J8Q5 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 93 1 UNP K8MH16_9STRE K8MH16 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 94 1 UNP A0A1E9A9F3_9STRE A0A1E9A9F3 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 95 1 UNP A0A1F0A2P4_9STRE A0A1F0A2P4 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 96 1 UNP A0A239SXC7_9STRE A0A239SXC7 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 97 1 UNP A0A3B0BFT2_9STRE A0A3B0BFT2 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 98 1 UNP A0A1B1IEL9_9STRE A0A1B1IEL9 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 99 1 UNP A0A4R0QE92_9STRE A0A4R0QE92 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 100 1 UNP A0A380JL73_STRCV A0A380JL73 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 101 1 UNP V8B7X6_STRPA V8B7X6 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 102 1 UNP A0A3R9N9U1_9STRE A0A3R9N9U1 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 103 1 UNP F9HEW6_9STRE F9HEW6 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 104 1 UNP A0A1E9B485_9STRE A0A1E9B485 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 105 1 UNP D2EN36_9STRE D2EN36 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 106 1 UNP A0A1F0BS89_9STRE A0A1F0BS89 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 107 1 UNP K0Z1V3_9STRE K0Z1V3 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 108 1 UNP A0A1S1GZ97_9STRE A0A1S1GZ97 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 109 1 UNP A0A6I4RJZ1_9STRE A0A6I4RJZ1 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 110 1 UNP A0AA96NSG2_9STRE A0AA96NSG2 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 111 1 UNP J1SEE1_9STRE J1SEE1 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 112 1 UNP A0A5M9QA14_LACLH A0A5M9QA14 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 113 1 UNP F2QFI3_STROU F2QFI3 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 114 1 UNP A0A501VXD6_9STRE A0A501VXD6 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 115 1 UNP I2J9W8_9STRE I2J9W8 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 116 1 UNP A0A1E8U0B9_9STRE A0A1E8U0B9 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 117 1 UNP X8K607_9STRE X8K607 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 118 1 UNP A0A1H0SC76_9STRE A0A1H0SC76 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 119 1 UNP D3HB68_STRM6 D3HB68 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 120 1 UNP A0A1E9GFE1_9STRE A0A1E9GFE1 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 121 1 UNP A0A6B0C1K9_STAAU A0A6B0C1K9 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 122 1 UNP A0A7X9MFL5_9STRE A0A7X9MFL5 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 123 1 UNP A0A139NFF2_9STRE A0A139NFF2 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 124 1 UNP A0A3P1V999_9STRE A0A3P1V999 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 125 1 UNP A0AAJ2T8W5_9STRE A0AAJ2T8W5 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 126 1 UNP F5VWU8_STROR F5VWU8 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 127 1 UNP A0A3R8LSI2_9STRE A0A3R8LSI2 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 128 1 UNP A0A1F0B3P0_9STRE A0A1F0B3P0 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 129 1 UNP I0Q4U5_STROR I0Q4U5 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 130 1 UNP R0LIU9_STRMT R0LIU9 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 131 1 UNP A0A7G9AXX3_9STRE A0A7G9AXX3 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 132 1 UNP E3CBZ2_STRPA E3CBZ2 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 133 1 UNP E1LMU0_STRMT E1LMU0 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 134 1 UNP A0A380L6H5_9STRE A0A380L6H5 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 135 1 UNP A0A6I3JA06_9STRE A0A6I3JA06 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 136 1 UNP F9P2Q1_STROR F9P2Q1 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 137 1 UNP I2J509_9STRE I2J509 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 138 1 UNP A0A0H3MT07_STRS4 A0A0H3MT07 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 139 1 UNP A0AAW7P8H7_9STRE A0AAW7P8H7 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 140 1 UNP S3ABA8_9STRE S3ABA8 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 141 1 UNP A0A1E9G3N7_9STRE A0A1E9G3N7 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' 142 1 UNP A0AAD2T8T9_STRAP A0AAD2T8T9 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 'Large ribosomal subunit protein bL36' # # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.seq_align_beg _struct_ref_seq.seq_align_end _struct_ref_seq.db_align_beg _struct_ref_seq.db_align_end 1 1 1 38 1 38 2 2 1 38 1 38 3 3 1 38 1 38 4 4 1 38 1 38 5 5 1 38 1 38 6 6 1 38 1 38 7 7 1 38 1 38 8 8 1 38 1 38 9 9 1 38 1 38 10 10 1 38 1 38 11 11 1 38 1 38 12 12 1 38 1 38 13 13 1 38 1 38 14 14 1 38 1 38 15 15 1 38 1 38 16 16 1 38 1 38 17 17 1 38 1 38 18 18 1 38 1 38 19 19 1 38 1 38 20 20 1 38 1 38 21 21 1 38 1 38 22 22 1 38 1 38 23 23 1 38 1 38 24 24 1 38 1 38 25 25 1 38 1 38 26 26 1 38 1 38 27 27 1 38 1 38 28 28 1 38 1 38 29 29 1 38 1 38 30 30 1 38 1 38 31 31 1 38 1 38 32 32 1 38 1 38 33 33 1 38 1 38 34 34 1 38 1 38 35 35 1 38 1 38 36 36 1 38 1 38 37 37 1 38 1 38 38 38 1 38 1 38 39 39 1 38 1 38 40 40 1 38 1 38 41 41 1 38 1 38 42 42 1 38 1 38 43 43 1 38 1 38 44 44 1 38 1 38 45 45 1 38 1 38 46 46 1 38 1 38 47 47 1 38 1 38 48 48 1 38 1 38 49 49 1 38 1 38 50 50 1 38 1 38 51 51 1 38 1 38 52 52 1 38 1 38 53 53 1 38 1 38 54 54 1 38 1 38 55 55 1 38 1 38 56 56 1 38 1 38 57 57 1 38 1 38 58 58 1 38 1 38 59 59 1 38 1 38 60 60 1 38 1 38 61 61 1 38 1 38 62 62 1 38 1 38 63 63 1 38 1 38 64 64 1 38 1 38 65 65 1 38 1 38 66 66 1 38 1 38 67 67 1 38 1 38 68 68 1 38 1 38 69 69 1 38 1 38 70 70 1 38 1 38 71 71 1 38 1 38 72 72 1 38 1 38 73 73 1 38 1 38 74 74 1 38 1 38 75 75 1 38 1 38 76 76 1 38 1 38 77 77 1 38 1 38 78 78 1 38 1 38 79 79 1 38 1 38 80 80 1 38 1 38 81 81 1 38 1 38 82 82 1 38 1 38 83 83 1 38 1 38 84 84 1 38 1 38 85 85 1 38 1 38 86 86 1 38 1 38 87 87 1 38 1 38 88 88 1 38 1 38 89 89 1 38 1 38 90 90 1 38 1 38 91 91 1 38 1 38 92 92 1 38 1 38 93 93 1 38 1 38 94 94 1 38 1 38 95 95 1 38 1 38 96 96 1 38 1 38 97 97 1 38 1 38 98 98 1 38 1 38 99 99 1 38 1 38 100 100 1 38 1 38 101 101 1 38 1 38 102 102 1 38 1 38 103 103 1 38 1 38 104 104 1 38 1 38 105 105 1 38 1 38 106 106 1 38 1 38 107 107 1 38 1 38 108 108 1 38 1 38 109 109 1 38 1 38 110 110 1 38 1 38 111 111 1 38 1 38 112 112 1 38 1 38 113 113 1 38 1 38 114 114 1 38 1 38 115 115 1 38 1 38 116 116 1 38 1 38 117 117 1 38 1 38 118 118 1 38 1 38 119 119 1 38 1 38 120 120 1 38 1 38 121 121 1 38 1 38 122 122 1 38 1 38 123 123 1 38 1 38 124 124 1 38 1 38 125 125 1 38 1 38 126 126 1 38 1 38 127 127 1 38 1 38 128 128 1 38 1 38 129 129 1 38 1 38 130 130 1 38 1 38 131 131 1 38 1 38 132 132 1 38 1 38 133 133 1 38 1 38 134 134 1 38 1 38 135 135 1 38 1 38 136 136 1 38 1 38 137 137 1 38 1 38 138 138 1 38 1 38 139 139 1 38 1 38 140 140 1 38 1 38 141 141 1 38 1 38 142 142 1 38 1 38 # # loop_ _ma_target_ref_db_details.target_entity_id _ma_target_ref_db_details.db_name _ma_target_ref_db_details.db_name_other_details _ma_target_ref_db_details.db_code _ma_target_ref_db_details.db_accession _ma_target_ref_db_details.seq_db_isoform _ma_target_ref_db_details.seq_db_align_begin _ma_target_ref_db_details.seq_db_align_end _ma_target_ref_db_details.ncbi_taxonomy_id _ma_target_ref_db_details.organism_scientific _ma_target_ref_db_details.seq_db_sequence_version_date _ma_target_ref_db_details.seq_db_sequence_checksum _ma_target_ref_db_details.is_primary 1 UNP . RL36_LACLA P0A493 . 1 38 272623 'Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)' 2005-03-15 892FEFE9A5939D88 . 1 UNP . RL36_LACLC P0A494 . 1 38 1359 'Lactococcus lactis subsp. cremoris (Streptococcus cremoris)' 2005-03-15 892FEFE9A5939D88 . 1 UNP . RL36_LACLM A2RNN0 . 1 38 416870 'Lactococcus lactis subsp. cremoris (strain MG1363)' 2007-03-06 892FEFE9A5939D88 . 1 UNP . RL36_LACLS Q02W48 . 1 38 272622 'Lactococcus lactis subsp. cremoris (strain SK11)' 2006-11-14 892FEFE9A5939D88 . 1 UNP . RL36_STRGC A8AZK2 . 1 38 467705 'Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 /DL1 / V288)' 2007-10-23 892FEFE9A5939D88 . 1 UNP . RL36_STRP7 C1CAN5 . 1 38 488221 'Streptococcus pneumoniae (strain 70585)' 2009-05-26 892FEFE9A5939D88 . 1 UNP . RL36_STRPI B1I8M1 . 1 38 487214 'Streptococcus pneumoniae (strain Hungary19A-6)' 2008-04-29 892FEFE9A5939D88 . 1 UNP . RL36_STRR6 P0A496 . 1 38 171101 'Streptococcus pneumoniae (strain ATCC BAA-255 / R6)' 2005-03-15 892FEFE9A5939D88 . 1 UNP . RL36_STRSV A3CK87 . 1 38 388919 'Streptococcus sanguinis (strain SK36)' 2007-03-20 892FEFE9A5939D88 . 1 UNP . RL36_STRPN P0A495 . 1 38 170187 'Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)' 2005-03-15 892FEFE9A5939D88 . 1 UNP . RL36_STRZT C1CPB1 . 1 38 487213 'Streptococcus pneumoniae (strain Taiwan19F-14)' 2009-05-26 892FEFE9A5939D88 . 1 UNP . RL36_STRZP C1CIC0 . 1 38 488223 'Streptococcus pneumoniae (strain P1031)' 2009-05-26 892FEFE9A5939D88 . 1 UNP . RL36_STRZJ C1CC29 . 1 38 488222 'Streptococcus pneumoniae (strain JJA)' 2009-05-26 892FEFE9A5939D88 . 1 UNP . A0AA96S445_9STRE A0AA96S445 . 1 38 3077584 'Streptococcus sp. DTU_2020_1001019_1_SI_AUS_MUR_006' 2024-03-27 892FEFE9A5939D88 . 1 UNP . A0AA49EYH9_9LACT A0AA49EYH9 . 1 38 2879149 'Lactococcus sp. NH2-7C' 2024-01-24 892FEFE9A5939D88 . 1 UNP . A0AA96ZZ32_9STRE A0AA96ZZ32 . 1 38 3028082 'Streptococcus suivaginalis' 2024-03-27 892FEFE9A5939D88 . 1 UNP . A0AB39LC39_9STRE A0AB39LC39 . 1 38 3238303 'Streptococcus sp. CP1998' 2025-02-05 892FEFE9A5939D88 . 1 UNP . A0AA97A2W6_9STRE A0AA97A2W6 . 1 38 3028083 'Streptococcus iners subsp. hyiners' 2024-03-27 892FEFE9A5939D88 . 1 UNP . A0AA96VLI0_9STRE A0AA96VLI0 . 1 38 3028084 'Streptococcus iners' 2024-03-27 892FEFE9A5939D88 . 1 UNP . A0AAU7PYI7_9STRE A0AAU7PYI7 . 1 38 3157339 'Streptococcus sp. KHUD_010' 2024-11-27 892FEFE9A5939D88 . 1 UNP . A0A5D4FU11_LACLL A0A5D4FU11 . 1 38 44688 'Lactococcus lactis subsp. lactis bv. diacetylactis' 2020-04-22 892FEFE9A5939D88 . 1 UNP . K2G061_9BACT K2G061 . 1 38 77133 'uncultured bacterium' 2012-11-28 892FEFE9A5939D88 . 1 UNP . A0A0F2CVM6_STROR A0A0F2CVM6 . 1 38 1891914 'Streptococcus oralis subsp. oralis' 2017-02-15 892FEFE9A5939D88 . 1 UNP . A0A1X1IYL8_STROR A0A1X1IYL8 . 1 38 1458253 'Streptococcus oralis subsp. dentisani' 2017-07-05 892FEFE9A5939D88 . 1 UNP . A0A1Q8EBS6_STRAI A0A1Q8EBS6 . 1 38 1326 'Streptococcus acidominimus' 2017-04-12 892FEFE9A5939D88 . 1 UNP . A0A1S9ZTV2_9STRE A0A1S9ZTV2 . 1 38 257758 'Streptococcus pseudopneumoniae' 2017-05-10 892FEFE9A5939D88 . 1 UNP . A0A354QR81_STRSP A0A354QR81 . 1 38 1306 'Streptococcus sp' 2018-11-07 892FEFE9A5939D88 . 1 UNP . A0A7X3KC05_9STRE A0A7X3KC05 . 1 38 747656 'Streptococcus danieliae' 2021-06-02 892FEFE9A5939D88 . 1 UNP . A0A098Z6X1_STREE A0A098Z6X1 . 1 38 1313 'Streptococcus pneumoniae' 2015-01-07 892FEFE9A5939D88 . 1 UNP . A0A380M6X0_9STRE A0A380M6X0 . 1 38 78535 'Streptococcus viridans' 2018-11-07 892FEFE9A5939D88 . 1 UNP . A0AAQ3A6N9_STRGN A0AAQ3A6N9 . 1 38 1302 'Streptococcus gordonii' 2024-10-02 892FEFE9A5939D88 . 1 UNP . A0A0K2E3D6_STRSU A0A0K2E3D6 . 1 38 1307 'Streptococcus suis' 2015-11-11 892FEFE9A5939D88 . 1 UNP . A0A2X3YS89_STRSA A0A2X3YS89 . 1 38 1305 'Streptococcus sanguinis' 2018-09-12 892FEFE9A5939D88 . 1 UNP . A0A269YVI5_9LACT A0A269YVI5 . 1 38 1358 'Lactococcus lactis' 2017-12-20 892FEFE9A5939D88 . 1 UNP . A0A0F2E799_STROR A0A0F2E799 . 1 38 1077464 'Streptococcus oralis subsp. tigurinus' 2017-02-15 892FEFE9A5939D88 . 1 UNP . A0A081PMH0_STRMT A0A081PMH0 . 1 38 28037 'Streptococcus mitis' 2014-10-29 892FEFE9A5939D88 . 1 UNP . A0A1Q8E5M4_9STRE A0A1Q8E5M4 . 1 38 1432788 'Streptococcus cuniculi' 2017-04-12 892FEFE9A5939D88 . 1 UNP . A0A0F2CRB0_STRCR A0A0F2CRB0 . 1 38 45634 'Streptococcus cristatus' 2015-06-24 892FEFE9A5939D88 . 1 UNP . A0AAW7NZ24_9STRE A0AAW7NZ24 . 1 38 3018246 'Streptococcus sp. SN3' 2024-11-27 892FEFE9A5939D88 . 1 UNP . A0A6D1TIA9_LACLC A0A6D1TIA9 . 1 38 1359 'Lactococcus lactis subsp. cremoris (Streptococcus cremoris)' 2020-06-17 892FEFE9A5939D88 . 1 UNP . A0A0A7T2G6_LACLL A0A0A7T2G6 . 1 38 1360 'Lactococcus lactis subsp. lactis (Streptococcus lactis)' 2015-03-04 892FEFE9A5939D88 . 1 UNP . A0AAE8FYL8_STRIT A0AAE8FYL8 . 1 38 1338 'Streptococcus intermedius' 2024-05-29 892FEFE9A5939D88 . 1 UNP . A0A1L8Q3X5_STROR A0A1L8Q3X5 . 1 38 1303 'Streptococcus oralis' 2017-03-15 892FEFE9A5939D88 . 1 UNP . A0A0F3HPM6_9STRE A0A0F3HPM6 . 1 38 68892 'Streptococcus infantis' 2017-02-15 892FEFE9A5939D88 . 1 UNP . A0A2I1UUY7_STRAP A0A2I1UUY7 . 1 38 1328 'Streptococcus anginosus' 2018-04-25 892FEFE9A5939D88 . 1 UNP . A0A0F3HB43_STRPA A0A0F3HB43 . 1 38 1318 'Streptococcus parasanguinis' 2015-06-24 892FEFE9A5939D88 . 1 UNP . A0A2J9EW94_9STRE A0A2J9EW94 . 1 38 1975706 'Streptococcus sp. FDAARGOS_256' 2018-03-28 892FEFE9A5939D88 . 1 UNP . E6J2R9_STRAP E6J2R9 . 1 38 706437 'Streptococcus anginosus F0211' 2011-03-08 892FEFE9A5939D88 . 1 UNP . I0SIG8_STRAP I0SIG8 . 1 38 1095729 'Streptococcus anginosus subsp. whileyi CCUG 39159' 2012-06-13 892FEFE9A5939D88 . 1 UNP . A0A4Z1DVZ6_9STRE A0A4Z1DVZ6 . 1 38 1234680 'Streptococcus rubneri' 2019-09-18 892FEFE9A5939D88 . 1 UNP . A0A0X8JZN8_9STRE A0A0X8JZN8 . 1 38 712633 'Streptococcus sp. oral taxon 431' 2016-04-13 892FEFE9A5939D88 . 1 UNP . A0A7H8ZA40_9STRE A0A7H8ZA40 . 1 38 712623 'Streptococcus sp. oral taxon 061' 2021-02-10 892FEFE9A5939D88 . 1 UNP . A0AB36JMW4_9STRE A0AB36JMW4 . 1 38 1579424 'Streptococcus azizii' 2025-02-05 892FEFE9A5939D88 . 1 UNP . A0A3P1VKX4_9STRE A0A3P1VKX4 . 1 38 2491052 'Streptococcus sp. OH4692_COT-348' 2019-02-13 892FEFE9A5939D88 . 1 UNP . A0AAV3EHD7_STRCR A0AAV3EHD7 . 1 38 889201 'Streptococcus cristatus ATCC 51100' 2024-11-27 892FEFE9A5939D88 . 1 UNP . A0AAW7P1A0_9STRE A0AAW7P1A0 . 1 38 3018250 'Streptococcus sp. SP1' 2024-11-27 892FEFE9A5939D88 . 1 UNP . A0A1F0NIB2_9STRE A0A1F0NIB2 . 1 38 1739491 'Streptococcus sp. HMSC067H01' 2017-02-15 892FEFE9A5939D88 . 1 UNP . A0A1F0BJ54_9STRE A0A1F0BJ54 . 1 38 1715098 'Streptococcus sp. HMSC074B11' 2017-02-15 892FEFE9A5939D88 . 1 UNP . W1TLS5_STRAP W1TLS5 . 1 38 1403946 'Streptococcus anginosus DORA_7' 2014-03-19 892FEFE9A5939D88 . 1 UNP . A0A371QE74_9STRE A0A371QE74 . 1 38 2292266 'Streptococcus sp. NM' 2018-11-07 892FEFE9A5939D88 . 1 UNP . A0A7X2VKT8_9STRE A0A7X2VKT8 . 1 38 2584682 'Streptococcus sp. BIOML-A1' 2021-06-02 892FEFE9A5939D88 . 1 UNP . K1A5J8_9STRE K1A5J8 . 1 38 1169673 'Streptococcus sp. GMD4S' 2012-11-28 892FEFE9A5939D88 . 1 UNP . A0A5B7Y877_9STRE A0A5B7Y877 . 1 38 2576376 'Streptococcus sp. 1643' 2019-11-13 892FEFE9A5939D88 . 1 UNP . A0A501PE39_9STRE A0A501PE39 . 1 38 2588991 'Streptococcus symci' 2019-09-18 892FEFE9A5939D88 . 1 UNP . A0A178K3N5_9STRE A0A178K3N5 . 1 38 1860161 'Streptococcus sp. CCUG 49591' 2016-11-02 892FEFE9A5939D88 . 1 UNP . J4XHW7_9STRE J4XHW7 . 1 38 1105032 'Streptococcus sp. BS35b' 2012-10-31 892FEFE9A5939D88 . 1 UNP . A0A3R9LRQ4_9STRE A0A3R9LRQ4 . 1 38 113107 'Streptococcus australis' 2019-04-10 892FEFE9A5939D88 . 1 UNP . A0A4Y9JHT8_9STRE A0A4Y9JHT8 . 1 38 2558276 'Streptococcus sp. LYSM12' 2019-09-18 892FEFE9A5939D88 . 1 UNP . S6EW07_LACLL S6EW07 . 1 38 1137134 'Lactococcus lactis subsp. lactis A12' 2013-10-16 892FEFE9A5939D88 . 1 UNP . A0A9X0WP03_9STRE A0A9X0WP03 . 1 38 684066 'Streptococcus lactarius' 2023-11-08 892FEFE9A5939D88 . 1 UNP . A0A7L8W328_9STRE A0A7L8W328 . 1 38 2598457 'Streptococcus sp. KS 6' 2021-06-02 892FEFE9A5939D88 . 1 UNP . F9HKM2_STRMT F9HKM2 . 1 38 1008453 'Streptococcus mitis SK1080' 2011-10-19 892FEFE9A5939D88 . 1 UNP . A0A3S9MTC9_9STRE A0A3S9MTC9 . 1 38 2490633 'Streptococcus periodonticum' 2019-05-08 892FEFE9A5939D88 . 1 UNP . A0A231W1U0_9STRE A0A231W1U0 . 1 38 1979528 'Streptococcus sp. KR' 2017-10-25 892FEFE9A5939D88 . 1 UNP . A0AAX3TIV8_9STRE A0AAX3TIV8 . 1 38 3038077 'Streptococcus sp. D7B5' 2024-11-27 892FEFE9A5939D88 . 1 UNP . A0A1F0TA11_9STRE A0A1F0TA11 . 1 38 1739461 'Streptococcus sp. HMSC062D07' 2017-02-15 892FEFE9A5939D88 . 1 UNP . F5W1R2_9STRE F5W1R2 . 1 38 1005705 'Streptococcus infantis SK1076' 2011-07-27 892FEFE9A5939D88 . 1 UNP . A0A1E1GCV2_9STRE A0A1E1GCV2 . 1 38 1902136 'Streptococcus sp. NPS 308' 2017-01-18 892FEFE9A5939D88 . 1 UNP . A0A1S1CZQ1_9STRE A0A1S1CZQ1 . 1 38 1715107 'Streptococcus sp. HMSC063B03' 2017-04-12 892FEFE9A5939D88 . 1 UNP . J4K7B2_STROR J4K7B2 . 1 38 1161421 'Streptococcus oralis SK304' 2012-10-31 892FEFE9A5939D88 . 1 UNP . T1ZGJ5_STRIT T1ZGJ5 . 1 38 862967 'Streptococcus intermedius B196' 2013-11-13 892FEFE9A5939D88 . 1 UNP . A0A2N6PRZ2_9STRE A0A2N6PRZ2 . 1 38 2069308 'Streptococcus sp. UMB0029' 2018-04-25 892FEFE9A5939D88 . 1 UNP . A0A3A5Q0B5_9STRE A0A3A5Q0B5 . 1 38 2293247 'Streptococcus sp. AM43-2AT' 2018-12-05 892FEFE9A5939D88 . 1 UNP . A0A5J6LL06_9STRE A0A5J6LL06 . 1 38 2610896 'Streptococcus sp. LPB0220' 2019-12-11 892FEFE9A5939D88 . 1 UNP . F9HBJ6_STRMT F9HBJ6 . 1 38 1008452 'Streptococcus mitis SK1073' 2011-10-19 892FEFE9A5939D88 . 1 UNP . A0A7X6MW54_9STRE A0A7X6MW54 . 1 38 1936207 'Streptococcus ovuberis' 2021-06-02 892FEFE9A5939D88 . 1 UNP . A0A4Q8L287_9STRE A0A4Q8L287 . 1 38 1501662 'Streptococcus parasuis' 2019-07-31 892FEFE9A5939D88 . 1 UNP . R0NSJ0_STRMT R0NSJ0 . 1 38 1239793 'Streptococcus mitis 13/39' 2013-06-26 892FEFE9A5939D88 . 1 UNP . I0SR83_STRMT I0SR83 . 1 38 1095736 'Streptococcus mitis SK575' 2012-06-13 892FEFE9A5939D88 . 1 UNP . A0A387AY47_9STRE A0A387AY47 . 1 38 1433513 'Streptococcus gwangjuensis' 2018-12-05 892FEFE9A5939D88 . 1 UNP . A0AAW7W467_9STRE A0AAW7W467 . 1 38 3063751 'Streptococcus sp. GP0011' 2024-11-27 892FEFE9A5939D88 . 1 UNP . A0AAI9J8Q5_9STRE A0AAI9J8Q5 . 1 38 1161413 'Streptococcus sp. ACC21' 2024-07-24 892FEFE9A5939D88 . 1 UNP . K8MH16_9STRE K8MH16 . 1 38 999425 'Streptococcus sp. F0442' 2013-02-06 892FEFE9A5939D88 . 1 UNP . A0A1E9A9F3_9STRE A0A1E9A9F3 . 1 38 1739309 'Streptococcus sp. HMSC034E03' 2017-02-15 892FEFE9A5939D88 . 1 UNP . A0A1F0A2P4_9STRE A0A1F0A2P4 . 1 38 1715207 'Streptococcus sp. HMSC061D10' 2017-02-15 892FEFE9A5939D88 . 1 UNP . A0A239SXC7_9STRE A0A239SXC7 . 1 38 400065 'Streptococcus merionis' 2017-10-25 892FEFE9A5939D88 . 1 UNP . A0A3B0BFT2_9STRE A0A3B0BFT2 . 1 38 2707003 'Streptococcus chosunensis' 2018-12-05 892FEFE9A5939D88 . 1 UNP . A0A1B1IEL9_9STRE A0A1B1IEL9 . 1 38 712624 'Streptococcus sp. oral taxon 064' 2016-11-02 892FEFE9A5939D88 . 1 UNP . A0A4R0QE92_9STRE A0A4R0QE92 . 1 38 2316646 'Streptococcus sp. X16XC17' 2019-07-31 892FEFE9A5939D88 . 1 UNP . A0A380JL73_STRCV A0A380JL73 . 1 38 76860 'Streptococcus constellatus' 2018-11-07 892FEFE9A5939D88 . 1 UNP . V8B7X6_STRPA V8B7X6 . 1 38 1073372 'Streptococcus parasanguinis CC87K' 2014-02-19 892FEFE9A5939D88 . 1 UNP . A0A3R9N9U1_9STRE A0A3R9N9U1 . 1 38 1759399 'Streptococcus sp. A12' 2019-04-10 892FEFE9A5939D88 . 1 UNP . F9HEW6_9STRE F9HEW6 . 1 38 904294 'Streptococcus sp. oral taxon 056 str. F0418' 2011-10-19 892FEFE9A5939D88 . 1 UNP . A0A1E9B485_9STRE A0A1E9B485 . 1 38 1739299 'Streptococcus sp. HMSC056C01' 2017-02-15 892FEFE9A5939D88 . 1 UNP . D2EN36_9STRE D2EN36 . 1 38 563037 'Streptococcus sp. M143' 2010-02-09 892FEFE9A5939D88 . 1 UNP . A0A1F0BS89_9STRE A0A1F0BS89 . 1 38 1715092 'Streptococcus sp. HMSC070B10' 2017-02-15 892FEFE9A5939D88 . 1 UNP . K0Z1V3_9STRE K0Z1V3 . 1 38 1169675 'Streptococcus sp. GMD6S' 2012-11-28 892FEFE9A5939D88 . 1 UNP . A0A1S1GZ97_9STRE A0A1S1GZ97 . 1 38 1608856 'Streptococcus sp. HMSC34B10' 2017-04-12 892FEFE9A5939D88 . 1 UNP . A0A6I4RJZ1_9STRE A0A6I4RJZ1 . 1 38 2664091 'Streptococcus zhangguiae' 2020-08-12 892FEFE9A5939D88 . 1 UNP . A0AA96NSG2_9STRE A0AA96NSG2 . 1 38 3077723 'Streptococcus sp. DTU_2020_1000888_1_SI_GRL_NUU_041A' 2024-03-27 892FEFE9A5939D88 . 1 UNP . J1SEE1_9STRE J1SEE1 . 1 38 1159208 'Streptococcus infantis SPAR10' 2012-10-03 892FEFE9A5939D88 . 1 UNP . A0A5M9QA14_LACLH A0A5M9QA14 . 1 38 203404 'Lactococcus lactis subsp. hordniae' 2020-02-26 892FEFE9A5939D88 . 1 UNP . F2QFI3_STROU F2QFI3 . 1 38 927666 'Streptococcus oralis (strain Uo5)' 2011-05-31 892FEFE9A5939D88 . 1 UNP . A0A501VXD6_9STRE A0A501VXD6 . 1 38 2589787 'Streptococcus sp. D2' 2019-09-18 892FEFE9A5939D88 . 1 UNP . I2J9W8_9STRE I2J9W8 . 1 38 1095727 'Streptococcus sp. SK643' 2012-07-11 892FEFE9A5939D88 . 1 UNP . A0A1E8U0B9_9STRE A0A1E8U0B9 . 1 38 1739341 'Streptococcus sp. HMSC071D03' 2017-02-15 892FEFE9A5939D88 . 1 UNP . X8K607_9STRE X8K607 . 1 38 1161416 'Streptococcus sp. SR1' 2014-06-11 892FEFE9A5939D88 . 1 UNP . A0A1H0SC76_9STRE A0A1H0SC76 . 1 38 1855327 'Streptococcus sp. NLAE-zl-C503' 2017-11-22 892FEFE9A5939D88 . 1 UNP . D3HB68_STRM6 D3HB68 . 1 38 365659 'Streptococcus mitis (strain B6)' 2010-03-23 892FEFE9A5939D88 . 1 UNP . A0A1E9GFE1_9STRE A0A1E9GFE1 . 1 38 1739268 'Streptococcus sp. HMSC073F11' 2017-02-15 892FEFE9A5939D88 . 1 UNP . A0A6B0C1K9_STAAU A0A6B0C1K9 . 1 38 1280 'Staphylococcus aureus' 2020-06-17 892FEFE9A5939D88 . 1 UNP . A0A7X9MFL5_9STRE A0A7X9MFL5 . 1 38 2725308 'Streptococcus sp. WB01_FAA12' 2021-06-02 892FEFE9A5939D88 . 1 UNP . A0A139NFF2_9STRE A0A139NFF2 . 1 38 1777878 'Streptococcus sp. DD10' 2016-05-11 892FEFE9A5939D88 . 1 UNP . A0A3P1V999_9STRE A0A3P1V999 . 1 38 229549 'Streptococcus minor' 2019-02-13 892FEFE9A5939D88 . 1 UNP . A0AAJ2T8W5_9STRE A0AAJ2T8W5 . 1 38 3095081 'Streptococcus sp. BJSWXB6CM1' 2024-07-24 892FEFE9A5939D88 . 1 UNP . F5VWU8_STROR F5VWU8 . 1 38 1005704 'Streptococcus oralis SK255' 2011-07-27 892FEFE9A5939D88 . 1 UNP . A0A3R8LSI2_9STRE A0A3R8LSI2 . 1 38 2172545 'Streptococcus halitosis' 2019-04-10 892FEFE9A5939D88 . 1 UNP . A0A1F0B3P0_9STRE A0A1F0B3P0 . 1 38 1715180 'Streptococcus sp. HMSC077D04' 2017-02-15 892FEFE9A5939D88 . 1 UNP . I0Q4U5_STROR I0Q4U5 . 1 38 1095741 'Streptococcus oralis SK610' 2012-06-13 892FEFE9A5939D88 . 1 UNP . R0LIU9_STRMT R0LIU9 . 1 38 1239792 'Streptococcus mitis 11/5' 2013-06-26 892FEFE9A5939D88 . 1 UNP . A0A7G9AXX3_9STRE A0A7G9AXX3 . 1 38 2763068 'Streptococcus sp. NSJ-72' 2021-02-10 892FEFE9A5939D88 . 1 UNP . E3CBZ2_STRPA E3CBZ2 . 1 38 905067 'Streptococcus parasanguinis F0405' 2011-01-11 892FEFE9A5939D88 . 1 UNP . E1LMU0_STRMT E1LMU0 . 1 38 585203 'Streptococcus mitis SK564' 2010-11-30 892FEFE9A5939D88 . 1 UNP . A0A380L6H5_9STRE A0A380L6H5 . 1 38 33040 'Streptococcus milleri' 2018-11-07 892FEFE9A5939D88 . 1 UNP . A0A6I3JA06_9STRE A0A6I3JA06 . 1 38 2663849 'Streptococcus sp. zg-36' 2020-08-12 892FEFE9A5939D88 . 1 UNP . F9P2Q1_STROR F9P2Q1 . 1 38 768726 'Streptococcus mitis bv. 2 str. F0392' 2011-10-19 892FEFE9A5939D88 . 1 UNP . I2J509_9STRE I2J509 . 1 38 1095726 'Streptococcus sp. SK140' 2012-07-11 892FEFE9A5939D88 . 1 UNP . A0A0H3MT07_STRS4 A0A0H3MT07 . 1 38 568814 'Streptococcus suis (strain BM407)' 2015-09-16 892FEFE9A5939D88 . 1 UNP . A0AAW7P8H7_9STRE A0AAW7P8H7 . 1 38 3018252 'Streptococcus sp. SP8' 2024-11-27 892FEFE9A5939D88 . 1 UNP . S3ABA8_9STRE S3ABA8 . 1 38 1203590 'Streptococcus sp. HPH0090' 2013-09-18 892FEFE9A5939D88 . 1 UNP . A0A1E9G3N7_9STRE A0A1E9G3N7 . 1 38 1739270 'Streptococcus sp. HMSC076C08' 2017-02-15 892FEFE9A5939D88 . 1 UNP . A0AAD2T8T9_STRAP A0AAD2T8T9 . 1 38 1161422 'Streptococcus anginosus SK1138' 2024-05-29 892FEFE9A5939D88 . # # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_strand_id _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can 1 polypeptide(L) no no H MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG # # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id _pdbx_entity_nonpoly.ma_model_mode 2 'ZINC ION' ZN implicit # # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET . 1 2 LYS . 1 3 VAL . 1 4 ARG . 1 5 PRO . 1 6 SER . 1 7 VAL . 1 8 LYS . 1 9 PRO . 1 10 ILE . 1 11 CYS . 1 12 GLU . 1 13 TYR . 1 14 CYS . 1 15 LYS . 1 16 VAL . 1 17 ILE . 1 18 ARG . 1 19 ARG . 1 20 ASN . 1 21 GLY . 1 22 ARG . 1 23 VAL . 1 24 MET . 1 25 VAL . 1 26 ILE . 1 27 CYS . 1 28 PRO . 1 29 ALA . 1 30 ASN . 1 31 PRO . 1 32 LYS . 1 33 HIS . 1 34 LYS . 1 35 GLN . 1 36 ARG . 1 37 GLN . 1 38 GLY . # # loop_ _struct_asym.id _struct_asym.entity_id _struct_asym.details A 1 . B 2 . # # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 MET 1 1 MET MET H . A 1 2 LYS 2 2 LYS LYS H . A 1 3 VAL 3 3 VAL VAL H . A 1 4 ARG 4 4 ARG ARG H . A 1 5 PRO 5 5 PRO PRO H . A 1 6 SER 6 6 SER SER H . A 1 7 VAL 7 7 VAL VAL H . A 1 8 LYS 8 8 LYS LYS H . A 1 9 PRO 9 9 PRO PRO H . A 1 10 ILE 10 10 ILE ILE H . A 1 11 CYS 11 11 CYS CYS H . A 1 12 GLU 12 12 GLU GLU H . A 1 13 TYR 13 13 TYR TYR H . A 1 14 CYS 14 14 CYS CYS H . A 1 15 LYS 15 15 LYS LYS H . A 1 16 VAL 16 16 VAL VAL H . A 1 17 ILE 17 17 ILE ILE H . A 1 18 ARG 18 18 ARG ARG H . A 1 19 ARG 19 19 ARG ARG H . A 1 20 ASN 20 20 ASN ASN H . A 1 21 GLY 21 21 GLY GLY H . A 1 22 ARG 22 22 ARG ARG H . A 1 23 VAL 23 23 VAL VAL H . A 1 24 MET 24 24 MET MET H . A 1 25 VAL 25 25 VAL VAL H . A 1 26 ILE 26 26 ILE ILE H . A 1 27 CYS 27 27 CYS CYS H . A 1 28 PRO 28 28 PRO PRO H . A 1 29 ALA 29 29 ALA ALA H . A 1 30 ASN 30 30 ASN ASN H . A 1 31 PRO 31 31 PRO PRO H . A 1 32 LYS 32 32 LYS LYS H . A 1 33 HIS 33 33 HIS HIS H . A 1 34 LYS 34 34 LYS LYS H . A 1 35 GLN 35 35 GLN GLN H . A 1 36 ARG 36 36 ARG ARG H . A 1 37 GLN 37 37 GLN GLN H . A 1 38 GLY 38 38 GLY GLY H . # # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 6 6 ZN '_' . # # loop_ _ma_data.id _ma_data.name _ma_data.content_type _ma_data.content_type_other_details 1 '50S ribosomal protein L36 {PDB ID=7nhk, label_asym_id=H, auth_asym_id=8, SMTL ID=7nhk.1.H}' 'template structure' . 2 'ZINC ION {PDB ID=7nhk, label_asym_id=GB, auth_asym_id=8, SMTL ID=7nhk.1._.6}' 'template structure' . 3 . target . 4 'ZINC ION' target . 5 'Target-template alignment by HHblits to 7nhk, label_asym_id=H' 'target-template alignment' . 6 'model 1' 'model coordinates' . 7 SMTL 'reference database' . 8 PDB 'reference database' . 9 'Template search output' other 'Results of the sequence search' # # loop_ _ma_data_group.ordinal_id _ma_data_group.group_id _ma_data_group.data_id 1 1 3 2 1 7 3 1 8 4 2 9 5 3 3 6 3 4 7 3 1 8 3 2 9 3 5 10 4 1 11 4 2 12 4 5 13 4 4 14 5 6 # # loop_ _ma_data_ref_db.data_id _ma_data_ref_db.name _ma_data_ref_db.location_url _ma_data_ref_db.version _ma_data_ref_db.release_date 7 SMTL https://swissmodel.expasy.org/templates/ . 2025-09-10 8 PDB https://www.wwpdb.org . 2025-09-05 # # loop_ _ma_target_entity.entity_id _ma_target_entity.data_id _ma_target_entity.origin 1 3 'reference database' 2 4 . # # loop_ _ma_target_entity_instance.asym_id _ma_target_entity_instance.entity_id _ma_target_entity_instance.details A 1 . B 2 . # # loop_ _ma_template_trans_matrix.id _ma_template_trans_matrix.rot_matrix[1][1] _ma_template_trans_matrix.rot_matrix[2][1] _ma_template_trans_matrix.rot_matrix[3][1] _ma_template_trans_matrix.rot_matrix[1][2] _ma_template_trans_matrix.rot_matrix[2][2] _ma_template_trans_matrix.rot_matrix[3][2] _ma_template_trans_matrix.rot_matrix[1][3] _ma_template_trans_matrix.rot_matrix[2][3] _ma_template_trans_matrix.rot_matrix[3][3] _ma_template_trans_matrix.tr_vector[1] _ma_template_trans_matrix.tr_vector[2] _ma_template_trans_matrix.tr_vector[3] 1 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0 0 0 # # loop_ _ma_template_details.ordinal_id _ma_template_details.template_id _ma_template_details.template_origin _ma_template_details.template_entity_type _ma_template_details.template_trans_matrix_id _ma_template_details.template_data_id _ma_template_details.target_asym_id _ma_template_details.template_label_asym_id _ma_template_details.template_label_entity_id _ma_template_details.template_model_num _ma_template_details.template_auth_asym_id 1 1 'reference database' polymer 1 1 A H 8 1 8 2 2 'reference database' non-polymer 1 2 B GB 56 1 8 # # loop_ _ma_template_poly.template_id _ma_template_poly.seq_one_letter_code _ma_template_poly.seq_one_letter_code_can 1 MKVRPSVKPMCEHCKVIRRKGRVMVICPANPKHKQRQG MKVRPSVKPMCEHCKVIRRKGRVMVICPANPKHKQRQG # # loop_ _ma_template_poly_segment.id _ma_template_poly_segment.template_id _ma_template_poly_segment.residue_number_begin _ma_template_poly_segment.residue_number_end 1 1 1 38 # # loop_ _ma_template_non_poly.template_id _ma_template_non_poly.comp_id _ma_template_non_poly.details 2 ZN 'ZINC ION' # # loop_ _ma_template_ref_db_details.template_id _ma_template_ref_db_details.db_name _ma_template_ref_db_details.db_name_other_details _ma_template_ref_db_details.db_accession_code _ma_template_ref_db_details.db_version_date 1 PDB . 7nhk 2024-07-10 2 PDB . 7nhk 2024-07-10 # # loop_ _ma_target_template_poly_mapping.id _ma_target_template_poly_mapping.template_segment_id _ma_target_template_poly_mapping.target_asym_id _ma_target_template_poly_mapping.target_seq_id_begin _ma_target_template_poly_mapping.target_seq_id_end 1 1 A 1 38 # # loop_ _ma_alignment_info.alignment_id _ma_alignment_info.data_id _ma_alignment_info.software_group_id _ma_alignment_info.alignment_length _ma_alignment_info.alignment_type _ma_alignment_info.alignment_mode 1 5 1 38 'target-template pairwise alignment' local # # loop_ _ma_alignment_details.ordinal_id _ma_alignment_details.alignment_id _ma_alignment_details.template_segment_id _ma_alignment_details.target_asym_id _ma_alignment_details.score_type _ma_alignment_details.score_type_other_details _ma_alignment_details.score_value _ma_alignment_details.percent_sequence_identity _ma_alignment_details.sequence_identity_denominator _ma_alignment_details.sequence_identity_denominator_other_details 1 1 1 A 'HHblits e-value' . 1.2e-25 92.105 'Number of aligned residue pairs (not including the gaps)' . # # loop_ _ma_alignment.ordinal_id _ma_alignment.alignment_id _ma_alignment.target_template_flag _ma_alignment.sequence 1 1 1 MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG 2 1 2 MKVRPSVKPMCEHCKVIRRKGRVMVICPANPKHKQRQG # # loop_ _ma_protocol_step.ordinal_id _ma_protocol_step.protocol_id _ma_protocol_step.step_id _ma_protocol_step.method_type _ma_protocol_step.step_name _ma_protocol_step.details _ma_protocol_step.software_group_id _ma_protocol_step.input_data_group_id _ma_protocol_step.output_data_group_id 1 1 1 'template search' 'template search' 'SWISS-MODEL template search in PDB' 2 1 2 2 1 2 'template selection' 'template selection' 'Automatic template selection by SWISS-MODEL {QSQE=0.000}' 3 2 4 3 1 3 modeling 'homology modeling' 'SWISS-MODEL auto-model mode using ProMod3 on 7nhk.1' 4 3 5 # # loop_ _ma_model_list.ordinal_id _ma_model_list.model_name _ma_model_list.data_id _ma_model_list.model_type _ma_model_list.model_type_other_details 1 'model 1' 6 'Homology model' . # # loop_ _ma_model_group.id _ma_model_group.name _ma_model_group.details 1 . . # # loop_ _ma_model_group_link.group_id _ma_model_group_link.model_id 1 1 # # loop_ _atom_site.group_PDB _atom_site.id _atom_site.type_symbol _atom_site.label_atom_id _atom_site.label_alt_id _atom_site.label_comp_id _atom_site.label_seq_id _atom_site.auth_seq_id _atom_site.pdbx_PDB_ins_code _atom_site.label_asym_id _atom_site.Cartn_x _atom_site.Cartn_y _atom_site.Cartn_z _atom_site.occupancy _atom_site.label_entity_id _atom_site.auth_asym_id _atom_site.auth_comp_id _atom_site.B_iso_or_equiv _atom_site.pdbx_PDB_model_num ATOM 1 N N . MET 1 1 ? A 187.050 188.763 248.479 1 1 H MET 0.770 1 ATOM 2 C CA . MET 1 1 ? A 185.592 189.033 248.740 1 1 H MET 0.770 1 ATOM 3 C C . MET 1 1 ? A 184.764 188.429 247.627 1 1 H MET 0.770 1 ATOM 4 O O . MET 1 1 ? A 185.211 188.439 246.488 1 1 H MET 0.770 1 ATOM 5 C CB . MET 1 1 ? A 185.356 190.576 248.776 1 1 H MET 0.770 1 ATOM 6 C CG . MET 1 1 ? A 183.908 191.014 249.070 1 1 H MET 0.770 1 ATOM 7 S SD . MET 1 1 ? A 183.317 190.416 250.669 1 1 H MET 0.770 1 ATOM 8 C CE . MET 1 1 ? A 184.086 191.704 251.689 1 1 H MET 0.770 1 ATOM 9 N N . LYS 2 2 ? A 183.568 187.880 247.906 1 1 H LYS 0.750 1 ATOM 10 C CA . LYS 2 2 ? A 182.671 187.428 246.867 1 1 H LYS 0.750 1 ATOM 11 C C . LYS 2 2 ? A 181.472 188.340 246.845 1 1 H LYS 0.750 1 ATOM 12 O O . LYS 2 2 ? A 180.629 188.305 247.735 1 1 H LYS 0.750 1 ATOM 13 C CB . LYS 2 2 ? A 182.227 185.991 247.191 1 1 H LYS 0.750 1 ATOM 14 C CG . LYS 2 2 ? A 183.377 184.992 247.011 1 1 H LYS 0.750 1 ATOM 15 C CD . LYS 2 2 ? A 183.004 183.564 247.430 1 1 H LYS 0.750 1 ATOM 16 C CE . LYS 2 2 ? A 184.131 182.540 247.250 1 1 H LYS 0.750 1 ATOM 17 N NZ . LYS 2 2 ? A 184.449 182.363 245.819 1 1 H LYS 0.750 1 ATOM 18 N N . VAL 3 3 ? A 181.374 189.191 245.813 1 1 H VAL 0.880 1 ATOM 19 C CA . VAL 3 3 ? A 180.283 190.133 245.697 1 1 H VAL 0.880 1 ATOM 20 C C . VAL 3 3 ? A 179.186 189.445 244.912 1 1 H VAL 0.880 1 ATOM 21 O O . VAL 3 3 ? A 179.409 188.951 243.812 1 1 H VAL 0.880 1 ATOM 22 C CB . VAL 3 3 ? A 180.738 191.444 245.072 1 1 H VAL 0.880 1 ATOM 23 C CG1 . VAL 3 3 ? A 179.563 192.425 244.944 1 1 H VAL 0.880 1 ATOM 24 C CG2 . VAL 3 3 ? A 181.843 192.049 245.964 1 1 H VAL 0.880 1 ATOM 25 N N . ARG 4 4 ? A 177.998 189.306 245.528 1 1 H ARG 0.780 1 ATOM 26 C CA . ARG 4 4 ? A 176.881 188.650 244.907 1 1 H ARG 0.780 1 ATOM 27 C C . ARG 4 4 ? A 175.586 189.029 245.620 1 1 H ARG 0.780 1 ATOM 28 O O . ARG 4 4 ? A 175.612 189.240 246.829 1 1 H ARG 0.780 1 ATOM 29 C CB . ARG 4 4 ? A 177.087 187.108 244.984 1 1 H ARG 0.780 1 ATOM 30 C CG . ARG 4 4 ? A 177.390 186.589 246.412 1 1 H ARG 0.780 1 ATOM 31 C CD . ARG 4 4 ? A 177.588 185.081 246.546 1 1 H ARG 0.780 1 ATOM 32 N NE . ARG 4 4 ? A 178.828 184.751 245.766 1 1 H ARG 0.780 1 ATOM 33 C CZ . ARG 4 4 ? A 179.292 183.510 245.613 1 1 H ARG 0.780 1 ATOM 34 N NH1 . ARG 4 4 ? A 178.738 182.488 246.252 1 1 H ARG 0.780 1 ATOM 35 N NH2 . ARG 4 4 ? A 180.294 183.263 244.754 1 1 H ARG 0.780 1 ATOM 36 N N . PRO 5 5 ? A 174.413 189.081 244.985 1 1 H PRO 0.830 1 ATOM 37 C CA . PRO 5 5 ? A 173.165 189.394 245.673 1 1 H PRO 0.830 1 ATOM 38 C C . PRO 5 5 ? A 172.718 188.189 246.475 1 1 H PRO 0.830 1 ATOM 39 O O . PRO 5 5 ? A 172.103 188.344 247.527 1 1 H PRO 0.830 1 ATOM 40 C CB . PRO 5 5 ? A 172.191 189.792 244.549 1 1 H PRO 0.830 1 ATOM 41 C CG . PRO 5 5 ? A 172.769 189.138 243.295 1 1 H PRO 0.830 1 ATOM 42 C CD . PRO 5 5 ? A 174.274 189.207 243.539 1 1 H PRO 0.830 1 ATOM 43 N N . SER 6 6 ? A 173.060 186.971 246.002 1 1 H SER 0.860 1 ATOM 44 C CA . SER 6 6 ? A 172.774 185.692 246.638 1 1 H SER 0.860 1 ATOM 45 C C . SER 6 6 ? A 173.757 185.358 247.748 1 1 H SER 0.860 1 ATOM 46 O O . SER 6 6 ? A 174.331 184.275 247.818 1 1 H SER 0.860 1 ATOM 47 C CB . SER 6 6 ? A 172.690 184.504 245.628 1 1 H SER 0.860 1 ATOM 48 O OG . SER 6 6 ? A 173.882 184.321 244.856 1 1 H SER 0.860 1 ATOM 49 N N . VAL 7 7 ? A 173.935 186.331 248.667 1 1 H VAL 0.840 1 ATOM 50 C CA . VAL 7 7 ? A 174.708 186.202 249.884 1 1 H VAL 0.840 1 ATOM 51 C C . VAL 7 7 ? A 174.014 185.245 250.840 1 1 H VAL 0.840 1 ATOM 52 O O . VAL 7 7 ? A 172.835 185.396 251.147 1 1 H VAL 0.840 1 ATOM 53 C CB . VAL 7 7 ? A 175.001 187.563 250.528 1 1 H VAL 0.840 1 ATOM 54 C CG1 . VAL 7 7 ? A 173.773 188.220 251.180 1 1 H VAL 0.840 1 ATOM 55 C CG2 . VAL 7 7 ? A 176.118 187.393 251.556 1 1 H VAL 0.840 1 ATOM 56 N N . LYS 8 8 ? A 174.715 184.192 251.298 1 1 H LYS 0.770 1 ATOM 57 C CA . LYS 8 8 ? A 174.158 183.280 252.270 1 1 H LYS 0.770 1 ATOM 58 C C . LYS 8 8 ? A 175.312 182.439 252.785 1 1 H LYS 0.770 1 ATOM 59 O O . LYS 8 8 ? A 176.299 182.273 252.066 1 1 H LYS 0.770 1 ATOM 60 C CB . LYS 8 8 ? A 172.989 182.401 251.719 1 1 H LYS 0.770 1 ATOM 61 C CG . LYS 8 8 ? A 173.341 181.489 250.539 1 1 H LYS 0.770 1 ATOM 62 C CD . LYS 8 8 ? A 172.086 180.780 249.998 1 1 H LYS 0.770 1 ATOM 63 C CE . LYS 8 8 ? A 172.353 179.735 248.917 1 1 H LYS 0.770 1 ATOM 64 N NZ . LYS 8 8 ? A 172.878 180.419 247.722 1 1 H LYS 0.770 1 ATOM 65 N N . PRO 9 9 ? A 175.279 181.919 254.005 1 1 H PRO 0.810 1 ATOM 66 C CA . PRO 9 9 ? A 176.441 181.287 254.609 1 1 H PRO 0.810 1 ATOM 67 C C . PRO 9 9 ? A 176.762 179.942 253.971 1 1 H PRO 0.810 1 ATOM 68 O O . PRO 9 9 ? A 175.882 179.284 253.423 1 1 H PRO 0.810 1 ATOM 69 C CB . PRO 9 9 ? A 176.061 181.195 256.096 1 1 H PRO 0.810 1 ATOM 70 C CG . PRO 9 9 ? A 174.538 181.134 256.108 1 1 H PRO 0.810 1 ATOM 71 C CD . PRO 9 9 ? A 174.158 182.029 254.938 1 1 H PRO 0.810 1 ATOM 72 N N . ILE 10 10 ? A 178.057 179.556 253.992 1 1 H ILE 0.820 1 ATOM 73 C CA . ILE 10 10 ? A 178.559 178.346 253.369 1 1 H ILE 0.820 1 ATOM 74 C C . ILE 10 10 ? A 178.889 177.276 254.419 1 1 H ILE 0.820 1 ATOM 75 O O . ILE 10 10 ? A 178.951 176.091 254.115 1 1 H ILE 0.820 1 ATOM 76 C CB . ILE 10 10 ? A 179.795 178.722 252.545 1 1 H ILE 0.820 1 ATOM 77 C CG1 . ILE 10 10 ? A 179.416 179.689 251.398 1 1 H ILE 0.820 1 ATOM 78 C CG2 . ILE 10 10 ? A 180.490 177.474 251.962 1 1 H ILE 0.820 1 ATOM 79 C CD1 . ILE 10 10 ? A 180.640 180.260 250.674 1 1 H ILE 0.820 1 ATOM 80 N N . CYS 11 11 ? A 179.053 177.664 255.705 1 1 H CYS 0.830 1 ATOM 81 C CA . CYS 11 11 ? A 179.402 176.759 256.790 1 1 H CYS 0.830 1 ATOM 82 C C . CYS 11 11 ? A 178.731 177.283 258.053 1 1 H CYS 0.830 1 ATOM 83 O O . CYS 11 11 ? A 178.209 178.382 258.083 1 1 H CYS 0.830 1 ATOM 84 C CB . CYS 11 11 ? A 180.944 176.617 257.023 1 1 H CYS 0.830 1 ATOM 85 S SG . CYS 11 11 ? A 181.793 178.055 257.761 1 1 H CYS 0.830 1 ATOM 86 N N . GLU 12 12 ? A 178.783 176.491 259.145 1 1 H GLU 0.750 1 ATOM 87 C CA . GLU 12 12 ? A 178.275 176.831 260.456 1 1 H GLU 0.750 1 ATOM 88 C C . GLU 12 12 ? A 179.023 177.958 261.163 1 1 H GLU 0.750 1 ATOM 89 O O . GLU 12 12 ? A 178.511 178.605 262.073 1 1 H GLU 0.750 1 ATOM 90 C CB . GLU 12 12 ? A 178.357 175.574 261.356 1 1 H GLU 0.750 1 ATOM 91 C CG . GLU 12 12 ? A 177.579 174.348 260.806 1 1 H GLU 0.750 1 ATOM 92 C CD . GLU 12 12 ? A 178.293 173.538 259.714 1 1 H GLU 0.750 1 ATOM 93 O OE1 . GLU 12 12 ? A 179.431 173.911 259.321 1 1 H GLU 0.750 1 ATOM 94 O OE2 . GLU 12 12 ? A 177.671 172.557 259.241 1 1 H GLU 0.750 1 ATOM 95 N N . TYR 13 13 ? A 180.277 178.247 260.756 1 1 H TYR 0.810 1 ATOM 96 C CA . TYR 13 13 ? A 181.088 179.274 261.389 1 1 H TYR 0.810 1 ATOM 97 C C . TYR 13 13 ? A 180.845 180.660 260.823 1 1 H TYR 0.810 1 ATOM 98 O O . TYR 13 13 ? A 181.296 181.649 261.407 1 1 H TYR 0.810 1 ATOM 99 C CB . TYR 13 13 ? A 182.601 178.981 261.273 1 1 H TYR 0.810 1 ATOM 100 C CG . TYR 13 13 ? A 182.971 177.800 262.101 1 1 H TYR 0.810 1 ATOM 101 C CD1 . TYR 13 13 ? A 183.117 177.944 263.486 1 1 H TYR 0.810 1 ATOM 102 C CD2 . TYR 13 13 ? A 183.196 176.548 261.514 1 1 H TYR 0.810 1 ATOM 103 C CE1 . TYR 13 13 ? A 183.494 176.854 264.276 1 1 H TYR 0.810 1 ATOM 104 C CE2 . TYR 13 13 ? A 183.574 175.453 262.305 1 1 H TYR 0.810 1 ATOM 105 C CZ . TYR 13 13 ? A 183.731 175.612 263.686 1 1 H TYR 0.810 1 ATOM 106 O OH . TYR 13 13 ? A 184.139 174.539 264.496 1 1 H TYR 0.810 1 ATOM 107 N N . CYS 14 14 ? A 180.110 180.750 259.700 1 1 H CYS 0.870 1 ATOM 108 C CA . CYS 14 14 ? A 179.750 181.988 259.040 1 1 H CYS 0.870 1 ATOM 109 C C . CYS 14 14 ? A 178.733 182.796 259.819 1 1 H CYS 0.870 1 ATOM 110 O O . CYS 14 14 ? A 177.657 182.321 260.161 1 1 H CYS 0.870 1 ATOM 111 C CB . CYS 14 14 ? A 179.130 181.742 257.646 1 1 H CYS 0.870 1 ATOM 112 S SG . CYS 14 14 ? A 180.295 181.083 256.426 1 1 H CYS 0.870 1 ATOM 113 N N . LYS 15 15 ? A 179.050 184.072 260.083 1 1 H LYS 0.810 1 ATOM 114 C CA . LYS 15 15 ? A 178.131 185.001 260.697 1 1 H LYS 0.810 1 ATOM 115 C C . LYS 15 15 ? A 177.655 185.946 259.616 1 1 H LYS 0.810 1 ATOM 116 O O . LYS 15 15 ? A 178.363 186.220 258.650 1 1 H LYS 0.810 1 ATOM 117 C CB . LYS 15 15 ? A 178.772 185.818 261.852 1 1 H LYS 0.810 1 ATOM 118 C CG . LYS 15 15 ? A 178.824 185.080 263.205 1 1 H LYS 0.810 1 ATOM 119 C CD . LYS 15 15 ? A 179.858 183.949 263.288 1 1 H LYS 0.810 1 ATOM 120 C CE . LYS 15 15 ? A 179.895 183.267 264.654 1 1 H LYS 0.810 1 ATOM 121 N NZ . LYS 15 15 ? A 180.845 182.138 264.590 1 1 H LYS 0.810 1 ATOM 122 N N . VAL 16 16 ? A 176.425 186.466 259.773 1 1 H VAL 0.870 1 ATOM 123 C CA . VAL 16 16 ? A 175.825 187.406 258.848 1 1 H VAL 0.870 1 ATOM 124 C C . VAL 16 16 ? A 175.683 188.702 259.604 1 1 H VAL 0.870 1 ATOM 125 O O . VAL 16 16 ? A 175.166 188.734 260.718 1 1 H VAL 0.870 1 ATOM 126 C CB . VAL 16 16 ? A 174.455 186.963 258.338 1 1 H VAL 0.870 1 ATOM 127 C CG1 . VAL 16 16 ? A 173.823 188.043 257.435 1 1 H VAL 0.870 1 ATOM 128 C CG2 . VAL 16 16 ? A 174.628 185.656 257.546 1 1 H VAL 0.870 1 ATOM 129 N N . ILE 17 17 ? A 176.186 189.804 259.024 1 1 H ILE 0.830 1 ATOM 130 C CA . ILE 17 17 ? A 176.201 191.099 259.675 1 1 H ILE 0.830 1 ATOM 131 C C . ILE 17 17 ? A 175.797 192.124 258.637 1 1 H ILE 0.830 1 ATOM 132 O O . ILE 17 17 ? A 176.240 192.096 257.492 1 1 H ILE 0.830 1 ATOM 133 C CB . ILE 17 17 ? A 177.581 191.443 260.259 1 1 H ILE 0.830 1 ATOM 134 C CG1 . ILE 17 17 ? A 177.963 190.438 261.375 1 1 H ILE 0.830 1 ATOM 135 C CG2 . ILE 17 17 ? A 177.618 192.892 260.801 1 1 H ILE 0.830 1 ATOM 136 C CD1 . ILE 17 17 ? A 179.385 190.570 261.933 1 1 H ILE 0.830 1 ATOM 137 N N . ARG 18 18 ? A 174.921 193.076 259.016 1 1 H ARG 0.700 1 ATOM 138 C CA . ARG 18 18 ? A 174.630 194.227 258.192 1 1 H ARG 0.700 1 ATOM 139 C C . ARG 18 18 ? A 175.571 195.345 258.599 1 1 H ARG 0.700 1 ATOM 140 O O . ARG 18 18 ? A 175.481 195.887 259.697 1 1 H ARG 0.700 1 ATOM 141 C CB . ARG 18 18 ? A 173.162 194.660 258.369 1 1 H ARG 0.700 1 ATOM 142 C CG . ARG 18 18 ? A 172.720 195.835 257.479 1 1 H ARG 0.700 1 ATOM 143 C CD . ARG 18 18 ? A 171.216 196.079 257.595 1 1 H ARG 0.700 1 ATOM 144 N NE . ARG 18 18 ? A 170.876 197.283 256.770 1 1 H ARG 0.700 1 ATOM 145 C CZ . ARG 18 18 ? A 169.635 197.792 256.697 1 1 H ARG 0.700 1 ATOM 146 N NH1 . ARG 18 18 ? A 168.618 197.213 257.325 1 1 H ARG 0.700 1 ATOM 147 N NH2 . ARG 18 18 ? A 169.408 198.877 255.961 1 1 H ARG 0.700 1 ATOM 148 N N . ARG 19 19 ? A 176.530 195.691 257.726 1 1 H ARG 0.710 1 ATOM 149 C CA . ARG 19 19 ? A 177.613 196.589 258.053 1 1 H ARG 0.710 1 ATOM 150 C C . ARG 19 19 ? A 177.677 197.668 256.985 1 1 H ARG 0.710 1 ATOM 151 O O . ARG 19 19 ? A 177.786 197.389 255.793 1 1 H ARG 0.710 1 ATOM 152 C CB . ARG 19 19 ? A 178.926 195.776 258.121 1 1 H ARG 0.710 1 ATOM 153 C CG . ARG 19 19 ? A 180.184 196.578 258.496 1 1 H ARG 0.710 1 ATOM 154 C CD . ARG 19 19 ? A 181.467 195.740 258.533 1 1 H ARG 0.710 1 ATOM 155 N NE . ARG 19 19 ? A 181.430 194.913 259.785 1 1 H ARG 0.710 1 ATOM 156 C CZ . ARG 19 19 ? A 182.313 193.945 260.069 1 1 H ARG 0.710 1 ATOM 157 N NH1 . ARG 19 19 ? A 183.264 193.616 259.199 1 1 H ARG 0.710 1 ATOM 158 N NH2 . ARG 19 19 ? A 182.260 193.302 261.233 1 1 H ARG 0.710 1 ATOM 159 N N . ASN 20 20 ? A 177.540 198.953 257.387 1 1 H ASN 0.760 1 ATOM 160 C CA . ASN 20 20 ? A 177.383 200.096 256.484 1 1 H ASN 0.760 1 ATOM 161 C C . ASN 20 20 ? A 176.161 199.983 255.580 1 1 H ASN 0.760 1 ATOM 162 O O . ASN 20 20 ? A 176.148 200.418 254.429 1 1 H ASN 0.760 1 ATOM 163 C CB . ASN 20 20 ? A 178.634 200.392 255.626 1 1 H ASN 0.760 1 ATOM 164 C CG . ASN 20 20 ? A 179.800 200.700 256.546 1 1 H ASN 0.760 1 ATOM 165 O OD1 . ASN 20 20 ? A 179.661 201.471 257.494 1 1 H ASN 0.760 1 ATOM 166 N ND2 . ASN 20 20 ? A 180.986 200.113 256.274 1 1 H ASN 0.760 1 ATOM 167 N N . GLY 21 21 ? A 175.099 199.347 256.108 1 1 H GLY 0.780 1 ATOM 168 C CA . GLY 21 21 ? A 173.841 199.117 255.424 1 1 H GLY 0.780 1 ATOM 169 C C . GLY 21 21 ? A 173.846 197.984 254.431 1 1 H GLY 0.780 1 ATOM 170 O O . GLY 21 21 ? A 172.790 197.642 253.915 1 1 H GLY 0.780 1 ATOM 171 N N . ARG 22 22 ? A 175.003 197.329 254.214 1 1 H ARG 0.690 1 ATOM 172 C CA . ARG 22 22 ? A 175.164 196.243 253.270 1 1 H ARG 0.690 1 ATOM 173 C C . ARG 22 22 ? A 175.220 194.934 254.020 1 1 H ARG 0.690 1 ATOM 174 O O . ARG 22 22 ? A 175.805 194.840 255.097 1 1 H ARG 0.690 1 ATOM 175 C CB . ARG 22 22 ? A 176.494 196.341 252.482 1 1 H ARG 0.690 1 ATOM 176 C CG . ARG 22 22 ? A 176.572 197.526 251.506 1 1 H ARG 0.690 1 ATOM 177 C CD . ARG 22 22 ? A 177.884 197.534 250.723 1 1 H ARG 0.690 1 ATOM 178 N NE . ARG 22 22 ? A 177.848 198.682 249.757 1 1 H ARG 0.690 1 ATOM 179 C CZ . ARG 22 22 ? A 178.307 199.917 250.023 1 1 H ARG 0.690 1 ATOM 180 N NH1 . ARG 22 22 ? A 178.773 200.240 251.225 1 1 H ARG 0.690 1 ATOM 181 N NH2 . ARG 22 22 ? A 178.255 200.857 249.084 1 1 H ARG 0.690 1 ATOM 182 N N . VAL 23 23 ? A 174.612 193.876 253.464 1 1 H VAL 0.830 1 ATOM 183 C CA . VAL 23 23 ? A 174.739 192.534 254.000 1 1 H VAL 0.830 1 ATOM 184 C C . VAL 23 23 ? A 176.125 191.973 253.709 1 1 H VAL 0.830 1 ATOM 185 O O . VAL 23 23 ? A 176.657 192.113 252.605 1 1 H VAL 0.830 1 ATOM 186 C CB . VAL 23 23 ? A 173.665 191.604 253.453 1 1 H VAL 0.830 1 ATOM 187 C CG1 . VAL 23 23 ? A 173.681 190.239 254.167 1 1 H VAL 0.830 1 ATOM 188 C CG2 . VAL 23 23 ? A 172.282 192.264 253.607 1 1 H VAL 0.830 1 ATOM 189 N N . MET 24 24 ? A 176.740 191.337 254.722 1 1 H MET 0.840 1 ATOM 190 C CA . MET 24 24 ? A 178.034 190.715 254.618 1 1 H MET 0.840 1 ATOM 191 C C . MET 24 24 ? A 178.025 189.391 255.358 1 1 H MET 0.840 1 ATOM 192 O O . MET 24 24 ? A 177.308 189.205 256.339 1 1 H MET 0.840 1 ATOM 193 C CB . MET 24 24 ? A 179.123 191.606 255.261 1 1 H MET 0.840 1 ATOM 194 C CG . MET 24 24 ? A 179.388 192.901 254.472 1 1 H MET 0.840 1 ATOM 195 S SD . MET 24 24 ? A 180.643 194.012 255.178 1 1 H MET 0.840 1 ATOM 196 C CE . MET 24 24 ? A 182.087 192.938 254.974 1 1 H MET 0.840 1 ATOM 197 N N . VAL 25 25 ? A 178.867 188.449 254.888 1 1 H VAL 0.880 1 ATOM 198 C CA . VAL 25 25 ? A 179.111 187.169 255.535 1 1 H VAL 0.880 1 ATOM 199 C C . VAL 25 25 ? A 180.562 187.152 255.920 1 1 H VAL 0.880 1 ATOM 200 O O . VAL 25 25 ? A 181.444 187.483 255.130 1 1 H VAL 0.880 1 ATOM 201 C CB . VAL 25 25 ? A 178.831 185.941 254.675 1 1 H VAL 0.880 1 ATOM 202 C CG1 . VAL 25 25 ? A 179.260 184.627 255.360 1 1 H VAL 0.880 1 ATOM 203 C CG2 . VAL 25 25 ? A 177.323 185.888 254.436 1 1 H VAL 0.880 1 ATOM 204 N N . ILE 26 26 ? A 180.822 186.789 257.187 1 1 H ILE 0.870 1 ATOM 205 C CA . ILE 26 26 ? A 182.154 186.736 257.742 1 1 H ILE 0.870 1 ATOM 206 C C . ILE 26 26 ? A 182.340 185.382 258.406 1 1 H ILE 0.870 1 ATOM 207 O O . ILE 26 26 ? A 181.611 185.001 259.317 1 1 H ILE 0.870 1 ATOM 208 C CB . ILE 26 26 ? A 182.398 187.873 258.743 1 1 H ILE 0.870 1 ATOM 209 C CG1 . ILE 26 26 ? A 182.270 189.263 258.064 1 1 H ILE 0.870 1 ATOM 210 C CG2 . ILE 26 26 ? A 183.784 187.728 259.419 1 1 H ILE 0.870 1 ATOM 211 C CD1 . ILE 26 26 ? A 180.879 189.909 258.154 1 1 H ILE 0.870 1 ATOM 212 N N . CYS 27 27 ? A 183.358 184.616 257.961 1 1 H CYS 0.890 1 ATOM 213 C CA . CYS 27 27 ? A 183.819 183.414 258.620 1 1 H CYS 0.890 1 ATOM 214 C C . CYS 27 27 ? A 185.279 183.685 258.968 1 1 H CYS 0.890 1 ATOM 215 O O . CYS 27 27 ? A 186.001 184.171 258.102 1 1 H CYS 0.890 1 ATOM 216 C CB . CYS 27 27 ? A 183.745 182.183 257.679 1 1 H CYS 0.890 1 ATOM 217 S SG . CYS 27 27 ? A 184.190 180.582 258.410 1 1 H CYS 0.890 1 ATOM 218 N N . PRO 28 28 ? A 185.762 183.425 260.179 1 1 H PRO 0.800 1 ATOM 219 C CA . PRO 28 28 ? A 187.177 183.553 260.506 1 1 H PRO 0.800 1 ATOM 220 C C . PRO 28 28 ? A 187.983 182.383 259.964 1 1 H PRO 0.800 1 ATOM 221 O O . PRO 28 28 ? A 189.151 182.574 259.644 1 1 H PRO 0.800 1 ATOM 222 C CB . PRO 28 28 ? A 187.201 183.612 262.045 1 1 H PRO 0.800 1 ATOM 223 C CG . PRO 28 28 ? A 185.917 182.902 262.476 1 1 H PRO 0.800 1 ATOM 224 C CD . PRO 28 28 ? A 184.933 183.253 261.367 1 1 H PRO 0.800 1 ATOM 225 N N . ALA 29 29 ? A 187.403 181.163 259.900 1 1 H ALA 0.810 1 ATOM 226 C CA . ALA 29 29 ? A 188.092 179.966 259.461 1 1 H ALA 0.810 1 ATOM 227 C C . ALA 29 29 ? A 188.460 179.937 257.980 1 1 H ALA 0.810 1 ATOM 228 O O . ALA 29 29 ? A 189.585 179.679 257.609 1 1 H ALA 0.810 1 ATOM 229 C CB . ALA 29 29 ? A 187.220 178.726 259.758 1 1 H ALA 0.810 1 ATOM 230 N N . ASN 30 30 ? A 187.469 180.219 257.100 1 1 H ASN 0.800 1 ATOM 231 C CA . ASN 30 30 ? A 187.688 180.215 255.672 1 1 H ASN 0.800 1 ATOM 232 C C . ASN 30 30 ? A 187.359 181.602 255.107 1 1 H ASN 0.800 1 ATOM 233 O O . ASN 30 30 ? A 186.180 181.944 254.990 1 1 H ASN 0.800 1 ATOM 234 C CB . ASN 30 30 ? A 186.796 179.135 255.013 1 1 H ASN 0.800 1 ATOM 235 C CG . ASN 30 30 ? A 187.185 178.895 253.561 1 1 H ASN 0.800 1 ATOM 236 O OD1 . ASN 30 30 ? A 188.063 179.536 252.980 1 1 H ASN 0.800 1 ATOM 237 N ND2 . ASN 30 30 ? A 186.480 177.940 252.914 1 1 H ASN 0.800 1 ATOM 238 N N . PRO 31 31 ? A 188.317 182.421 254.676 1 1 H PRO 0.840 1 ATOM 239 C CA . PRO 31 31 ? A 188.055 183.742 254.123 1 1 H PRO 0.840 1 ATOM 240 C C . PRO 31 31 ? A 187.466 183.666 252.728 1 1 H PRO 0.840 1 ATOM 241 O O . PRO 31 31 ? A 187.071 184.695 252.193 1 1 H PRO 0.840 1 ATOM 242 C CB . PRO 31 31 ? A 189.419 184.440 254.141 1 1 H PRO 0.840 1 ATOM 243 C CG . PRO 31 31 ? A 190.411 183.290 254.015 1 1 H PRO 0.840 1 ATOM 244 C CD . PRO 31 31 ? A 189.750 182.172 254.817 1 1 H PRO 0.840 1 ATOM 245 N N . LYS 32 32 ? A 187.355 182.461 252.126 1 1 H LYS 0.810 1 ATOM 246 C CA . LYS 32 32 ? A 186.602 182.254 250.903 1 1 H LYS 0.810 1 ATOM 247 C C . LYS 32 32 ? A 185.112 182.265 251.158 1 1 H LYS 0.810 1 ATOM 248 O O . LYS 32 32 ? A 184.310 182.341 250.233 1 1 H LYS 0.810 1 ATOM 249 C CB . LYS 32 32 ? A 186.944 180.921 250.205 1 1 H LYS 0.810 1 ATOM 250 C CG . LYS 32 32 ? A 188.353 180.895 249.608 1 1 H LYS 0.810 1 ATOM 251 C CD . LYS 32 32 ? A 188.637 179.599 248.830 1 1 H LYS 0.810 1 ATOM 252 C CE . LYS 32 32 ? A 188.906 178.395 249.738 1 1 H LYS 0.810 1 ATOM 253 N NZ . LYS 32 32 ? A 189.234 177.196 248.931 1 1 H LYS 0.810 1 ATOM 254 N N . HIS 33 33 ? A 184.700 182.208 252.433 1 1 H HIS 0.810 1 ATOM 255 C CA . HIS 33 33 ? A 183.312 182.332 252.791 1 1 H HIS 0.810 1 ATOM 256 C C . HIS 33 33 ? A 182.937 183.766 253.080 1 1 H HIS 0.810 1 ATOM 257 O O . HIS 33 33 ? A 181.802 184.070 253.425 1 1 H HIS 0.810 1 ATOM 258 C CB . HIS 33 33 ? A 183.019 181.489 254.031 1 1 H HIS 0.810 1 ATOM 259 C CG . HIS 33 33 ? A 183.258 180.030 253.852 1 1 H HIS 0.810 1 ATOM 260 N ND1 . HIS 33 33 ? A 183.157 179.233 254.972 1 1 H HIS 0.810 1 ATOM 261 C CD2 . HIS 33 33 ? A 183.410 179.264 252.744 1 1 H HIS 0.810 1 ATOM 262 C CE1 . HIS 33 33 ? A 183.237 178.001 254.530 1 1 H HIS 0.810 1 ATOM 263 N NE2 . HIS 33 33 ? A 183.396 177.955 253.184 1 1 H HIS 0.810 1 ATOM 264 N N . LYS 34 34 ? A 183.894 184.691 252.901 1 1 H LYS 0.830 1 ATOM 265 C CA . LYS 34 34 ? A 183.665 186.113 252.972 1 1 H LYS 0.830 1 ATOM 266 C C . LYS 34 34 ? A 182.910 186.653 251.762 1 1 H LYS 0.830 1 ATOM 267 O O . LYS 34 34 ? A 183.385 186.611 250.626 1 1 H LYS 0.830 1 ATOM 268 C CB . LYS 34 34 ? A 185.021 186.830 253.074 1 1 H LYS 0.830 1 ATOM 269 C CG . LYS 34 34 ? A 184.943 188.324 253.391 1 1 H LYS 0.830 1 ATOM 270 C CD . LYS 34 34 ? A 186.321 189.001 253.301 1 1 H LYS 0.830 1 ATOM 271 C CE . LYS 34 34 ? A 187.277 188.564 254.417 1 1 H LYS 0.830 1 ATOM 272 N NZ . LYS 34 34 ? A 188.586 189.255 254.316 1 1 H LYS 0.830 1 ATOM 273 N N . GLN 35 35 ? A 181.709 187.209 252.005 1 1 H GLN 0.850 1 ATOM 274 C CA . GLN 35 35 ? A 180.801 187.601 250.951 1 1 H GLN 0.850 1 ATOM 275 C C . GLN 35 35 ? A 180.193 188.955 251.240 1 1 H GLN 0.850 1 ATOM 276 O O . GLN 35 35 ? A 180.173 189.429 252.374 1 1 H GLN 0.850 1 ATOM 277 C CB . GLN 35 35 ? A 179.621 186.615 250.808 1 1 H GLN 0.850 1 ATOM 278 C CG . GLN 35 35 ? A 179.998 185.160 250.488 1 1 H GLN 0.850 1 ATOM 279 C CD . GLN 35 35 ? A 178.751 184.282 250.425 1 1 H GLN 0.850 1 ATOM 280 O OE1 . GLN 35 35 ? A 177.611 184.682 250.646 1 1 H GLN 0.850 1 ATOM 281 N NE2 . GLN 35 35 ? A 178.972 182.991 250.086 1 1 H GLN 0.850 1 ATOM 282 N N . ARG 36 36 ? A 179.672 189.602 250.184 1 1 H ARG 0.780 1 ATOM 283 C CA . ARG 36 36 ? A 179.057 190.903 250.264 1 1 H ARG 0.780 1 ATOM 284 C C . ARG 36 36 ? A 178.027 190.995 249.153 1 1 H ARG 0.780 1 ATOM 285 O O . ARG 36 36 ? A 178.115 190.294 248.159 1 1 H ARG 0.780 1 ATOM 286 C CB . ARG 36 36 ? A 180.132 192.011 250.083 1 1 H ARG 0.780 1 ATOM 287 C CG . ARG 36 36 ? A 179.618 193.458 250.211 1 1 H ARG 0.780 1 ATOM 288 C CD . ARG 36 36 ? A 180.694 194.552 250.259 1 1 H ARG 0.780 1 ATOM 289 N NE . ARG 36 36 ? A 181.358 194.671 248.916 1 1 H ARG 0.780 1 ATOM 290 C CZ . ARG 36 36 ? A 180.893 195.363 247.865 1 1 H ARG 0.780 1 ATOM 291 N NH1 . ARG 36 36 ? A 179.669 195.906 247.857 1 1 H ARG 0.780 1 ATOM 292 N NH2 . ARG 36 36 ? A 181.600 195.439 246.747 1 1 H ARG 0.780 1 ATOM 293 N N . GLN 37 37 ? A 177.017 191.869 249.308 1 1 H GLN 0.720 1 ATOM 294 C CA . GLN 37 37 ? A 176.084 192.207 248.253 1 1 H GLN 0.720 1 ATOM 295 C C . GLN 37 37 ? A 176.564 193.350 247.368 1 1 H GLN 0.720 1 ATOM 296 O O . GLN 37 37 ? A 177.240 194.285 247.813 1 1 H GLN 0.720 1 ATOM 297 C CB . GLN 37 37 ? A 174.716 192.545 248.869 1 1 H GLN 0.720 1 ATOM 298 C CG . GLN 37 37 ? A 173.979 191.276 249.342 1 1 H GLN 0.720 1 ATOM 299 C CD . GLN 37 37 ? A 172.636 191.645 249.964 1 1 H GLN 0.720 1 ATOM 300 O OE1 . GLN 37 37 ? A 172.416 192.783 250.376 1 1 H GLN 0.720 1 ATOM 301 N NE2 . GLN 37 37 ? A 171.718 190.656 250.072 1 1 H GLN 0.720 1 ATOM 302 N N . GLY 38 38 ? A 176.223 193.284 246.072 1 1 H GLY 0.550 1 ATOM 303 C CA . GLY 38 38 ? A 176.512 194.296 245.084 1 1 H GLY 0.550 1 ATOM 304 C C . GLY 38 38 ? A 176.249 193.661 243.711 1 1 H GLY 0.550 1 ATOM 305 O O . GLY 38 38 ? A 175.798 192.481 243.680 1 1 H GLY 0.550 1 ATOM 306 O OXT . GLY 38 38 ? A 176.509 194.349 242.692 1 1 H GLY 0.550 1 HETATM 307 ZN ZN . ZN . 6 ? B 182.393 180.333 256.984 1 2 '_' ZN . 1 # # loop_ _atom_type.symbol C N O S ZN # # loop_ _ma_qa_metric.id _ma_qa_metric.name _ma_qa_metric.description _ma_qa_metric.type _ma_qa_metric.mode _ma_qa_metric.type_other_details _ma_qa_metric.software_group_id 1 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].' 'pLDDT all-atom in [0,1]' local . 5 2 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].' 'pLDDT all-atom in [0,1]' global . 5 3 GMQE 'Global Model Quality Estimate of the model accuracy, calculated by SWISS-MODEL.' 'normalized score' global . 6 # # loop_ _ma_qa_metric_global.ordinal_id _ma_qa_metric_global.model_id _ma_qa_metric_global.metric_id _ma_qa_metric_global.metric_value 1 1 2 0.801 2 1 3 0.837 # # loop_ _ma_qa_metric_local.ordinal_id _ma_qa_metric_local.model_id _ma_qa_metric_local.label_asym_id _ma_qa_metric_local.label_seq_id _ma_qa_metric_local.label_comp_id _ma_qa_metric_local.metric_id _ma_qa_metric_local.metric_value 1 1 A 1 MET 1 0.770 2 1 A 2 LYS 1 0.750 3 1 A 3 VAL 1 0.880 4 1 A 4 ARG 1 0.780 5 1 A 5 PRO 1 0.830 6 1 A 6 SER 1 0.860 7 1 A 7 VAL 1 0.840 8 1 A 8 LYS 1 0.770 9 1 A 9 PRO 1 0.810 10 1 A 10 ILE 1 0.820 11 1 A 11 CYS 1 0.830 12 1 A 12 GLU 1 0.750 13 1 A 13 TYR 1 0.810 14 1 A 14 CYS 1 0.870 15 1 A 15 LYS 1 0.810 16 1 A 16 VAL 1 0.870 17 1 A 17 ILE 1 0.830 18 1 A 18 ARG 1 0.700 19 1 A 19 ARG 1 0.710 20 1 A 20 ASN 1 0.760 21 1 A 21 GLY 1 0.780 22 1 A 22 ARG 1 0.690 23 1 A 23 VAL 1 0.830 24 1 A 24 MET 1 0.840 25 1 A 25 VAL 1 0.880 26 1 A 26 ILE 1 0.870 27 1 A 27 CYS 1 0.890 28 1 A 28 PRO 1 0.800 29 1 A 29 ALA 1 0.810 30 1 A 30 ASN 1 0.800 31 1 A 31 PRO 1 0.840 32 1 A 32 LYS 1 0.810 33 1 A 33 HIS 1 0.810 34 1 A 34 LYS 1 0.830 35 1 A 35 GLN 1 0.850 36 1 A 36 ARG 1 0.780 37 1 A 37 GLN 1 0.720 38 1 A 38 GLY 1 0.550 #