data_SMR-7db6d529a73eab2fa98377e4c58930b8_2 _entry.id SMR-7db6d529a73eab2fa98377e4c58930b8_2 _struct.entry_id SMR-7db6d529a73eab2fa98377e4c58930b8_2 _struct.pdbx_model_details ;This model was generated unsupervised by the SWISS-MODEL homology-modelling pipeline for the SWISS-MODEL Repository, a database of annotated 3D protein structure models. The modelled monomer covers following UniProtKB entries: - A0A0J9RUT5/ A0A0J9RUT5_DROSI, Acp70A, isoform A - A0A6P8JSX6/ A0A6P8JSX6_DROMA, Accessory gland-specific peptide 70A - P67806/ A70A_DROMA, Accessory gland-specific peptide 70A - P67807/ A70A_DROSI, Accessory gland-specific peptide 70A Estimated model accuracy of this model is 0.172, calculated by SWISS-MODEL as Global Model Quality Estimate (GMQE). ; _struct.pdbx_structure_determination_methodology computational _struct.title 'Model for UniProtKB entries A0A0J9RUT5, A0A6P8JSX6, P67806, P67807' _audit_conform.dict_location https://raw.githubusercontent.com/ihmwg/ModelCIF/80e1e22/dist/mmcif_ma.dic _audit_conform.dict_name mmcif_ma.dic _audit_conform.dict_version 1.4.7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'The SWISS-MODEL Repository - new features and functionality' 'Nucleic Acids Res.' 45 D313 D319 2017 27899672 10.1093/nar/gkw1132 2 'SWISS-MODEL: homology modelling of protein structures and complexes' 'Nucleic Acids Res.' 46 W296 W303 2018 29788355 10.1093/nar/gky427 3 'ProMod3 - A versatile homology modelling toolbox' 'PLoS Comput. Biol.' 17(1) 1 18 2021 33507980 10.1371/journal.pcbi.1008667 4 'QMEANDisCo - distance constraints applied on model quality estimation' Bioinformatics 36 1765 1771 2020 31697312 10.1093/bioinformatics/btz828 5 'OpenStructure: an integrated software framework for computational structural biology' 'Acta Crystallogr., Sect. D: Biol. Crystallogr.' 69 701 709 2013 23633579 10.1107/S0907444913007051 6 'BLAST+: architecture and applications' 'BMC Bioinf.' 10 421 . 2009 20003500 10.1186/1471-2105-10-421 7 'HH-suite3 for fast remote homology detection and deep protein annotation' 'BMC Bioinf.' 20 473 . 2019 31521110 10.1186/s12859-019-3019-7 # # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Bienert, S.' 1 primary 'Waterhouse, A.' 2 primary 'de Beer, T.A.P.' 3 primary 'Tauriello, G.' 4 primary 'Studer, G.' 5 primary 'Bordoli, L.' 6 primary 'Schwede, T.' 7 2 'Waterhouse, A.' 8 2 'Bertoni, M.' 9 2 'Bienert, S.' 10 2 'Studer, G.' 11 2 'Tauriello, G.' 12 2 'Gumienny, R.' 13 2 'Heer, F.T.' 14 2 'de Beer, T.A.P.' 15 2 'Rempfer, C.' 16 2 'Bordoli, L.' 17 2 'Lepore, R.' 18 2 'Schwede, T.' 19 3 'Studer, G.' 20 3 'Tauriello, G.' 21 3 'Bienert, S.' 22 3 'Biasini, M.' 23 3 'Johner, N.' 24 3 'Schwede, T.' 25 4 'Studer, G.' 26 4 'Rempfer, C.' 27 4 'Waterhouse, A.M.' 28 4 'Gumienny, R.' 29 4 'Haas, J.' 30 4 'Schwede, T.' 31 5 'Biasini, M.' 32 5 'Schmidt, T.' 33 5 'Bienert, S.' 34 5 'Mariani, V.' 35 5 'Studer, G.' 36 5 'Haas, J.' 37 5 'Johner, N.' 38 5 'Schenk, A.D.' 39 5 'Philippsen, A.' 40 5 'Schwede, T.' 41 6 'Camacho, C.' 42 6 'Coulouris, G.' 43 6 'Avagyan, V.' 44 6 'Ma, N.' 45 6 'Papadopoulos, J.' 46 6 'Bealer, K.' 47 6 'Madden, T.L.' 48 7 'Steinegger, M.' 49 7 'Meier, M.' 50 7 'Mirdita, M.' 51 7 'Vohringer, H.' 52 7 'Haunsberger, S.J.' 53 7 'Soding, J.' 54 # # loop_ _software.pdbx_ordinal _software.name _software.classification _software.description _software.version _software.type _software.location _software.citation_id 1 SWISS-MODEL 'model building' 'Homology modelling web service' 2025-10.6 package https://swissmodel.expasy.org 2 2 ProMod3 'model building' 'Modular homology modelling engine' 3.6.0 library https://git.scicore.unibas.ch/schwede/ProMod3 3 3 QMEAN 'model building' 'QMEAN - Qualitative Model Energy ANalysis' 4.5.0 library https://git.scicore.unibas.ch/schwede/QMEAN 4 4 OpenStructure 'data processing' 'Open-Source Computational Structural Biology Framework' 2.11.1 package https://openstructure.org/ 5 5 BLAST 'data collection' . 2.14.1 package https://blast.ncbi.nlm.nih.gov 6 6 HH-suite 'data collection' 'HH-suite3 for sensitive sequence searching' 3.2.0 package https://github.com/soedinglab/hh-suite 7 # # loop_ _ma_software_group.ordinal_id _ma_software_group.group_id _ma_software_group.software_id _ma_software_group.parameter_group_id 1 1 6 . 2 2 1 . 3 2 4 . 4 2 5 . 5 2 6 . 6 3 1 . 7 3 4 . 8 4 1 . 9 4 2 . 10 4 4 . 11 5 3 . 12 6 1 . 13 6 3 . 14 6 4 . # # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bienert, S.' 1 'Waterhouse, A.' 2 'de Beer, T.A.P.' 3 'Tauriello, G.' 4 'Studer, G.' 5 'Bordoli, L.' 6 'Schwede, T.' 7 # # loop_ _pdbx_data_usage.id _pdbx_data_usage.type _pdbx_data_usage.details _pdbx_data_usage.url _pdbx_data_usage.name 1 license ;This SWISS-MODEL protein model is copyright. It is produced by the SWISS-MODEL server, developed by the Computational Structural Biology Group at the SIB Swiss Institute of Bioinformatics at the Biozentrum, University of Basel (https://swissmodel.expasy.org). This model is licensed under the CC BY-SA 4.0 Creative Commons Attribution-ShareAlike 4.0 International License (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you can copy and redistribute the model in any medium or format, transform and build upon the model for any purpose, even commercially, under the following terms: Attribution - You must give appropriate credit, provide a link to the license, and indicate if changes were made. You may do so in any reasonable manner, but not in any way that suggests the licensor endorses you or your use. When you publish, patent or distribute results that were fully or partially based on the model, please cite the corresponding papers mentioned under JRNL. ShareAlike - If you remix, transform, or build upon the material, you must distribute your contributions under the same license as the original. No additional restrictions - you may not apply legal terms or technological measures that legally restrict others from doing anything the license permits. Find a human-readable summary of (and not a substitute for) the CC BY-SA 4.0 license at this link: https://creativecommons.org/licenses/by-sa/4.0/ ; https://creativecommons.org/licenses/by-sa/4.0/legalcode 'Attribution-ShareAlike 4.0 International' 2 disclaimer ;The SWISS-MODEL SERVER produces theoretical models for proteins. The results of any theoretical modelling procedure is NON-EXPERIMENTAL and MUST be considered with care. These models may contain significant errors. This is especially true for automated modeling since there is no human intervention during model building. Please read the header section and the logfile carefully to know what templates and alignments were used during the model building process. All information by the SWISS-MODEL SERVER is provided "AS-IS", without any warranty, expressed or implied. ; https://swissmodel.expasy.org/docs/terms_of_use#disclaimer . # # loop_ _chem_comp.id _chem_comp.type _chem_comp.name _chem_comp.formula _chem_comp.formula_weight _chem_comp.ma_provenance ALA 'L-peptide linking' ALANINE 'C3 H7 N O2' 89.094 'CCD Core' ARG 'L-peptide linking' ARGININE 'C6 H15 N4 O2 1' 175.212 'CCD Core' ASN 'L-peptide linking' ASPARAGINE 'C4 H8 N2 O3' 132.119 'CCD Core' ASP 'L-peptide linking' 'ASPARTIC ACID' 'C4 H7 N O4' 133.103 'CCD Core' CYS 'L-peptide linking' CYSTEINE 'C3 H7 N O2 S' 121.154 'CCD Core' GLN 'L-peptide linking' GLUTAMINE 'C5 H10 N2 O3' 146.146 'CCD Core' GLU 'L-peptide linking' 'GLUTAMIC ACID' 'C5 H9 N O4' 147.130 'CCD Core' GLY 'peptide linking' GLYCINE 'C2 H5 N O2' 75.067 'CCD Core' ILE 'L-peptide linking' ISOLEUCINE 'C6 H13 N O2' 131.175 'CCD Core' LEU 'L-peptide linking' LEUCINE 'C6 H13 N O2' 131.175 'CCD Core' LYS 'L-peptide linking' LYSINE 'C6 H15 N2 O2 1' 147.198 'CCD Core' MET 'L-peptide linking' METHIONINE 'C5 H11 N O2 S' 149.208 'CCD Core' PHE 'L-peptide linking' PHENYLALANINE 'C9 H11 N O2' 165.192 'CCD Core' PRO 'L-peptide linking' PROLINE 'C5 H9 N O2' 115.132 'CCD Core' SER 'L-peptide linking' SERINE 'C3 H7 N O3' 105.093 'CCD Core' THR 'L-peptide linking' THREONINE 'C4 H9 N O3' 119.120 'CCD Core' TRP 'L-peptide linking' TRYPTOPHAN 'C11 H12 N2 O2' 204.229 'CCD Core' TYR 'L-peptide linking' TYROSINE 'C9 H11 N O3' 181.191 'CCD Core' VAL 'L-peptide linking' VALINE 'C5 H11 N O2' 117.148 'CCD Core' # # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.details 1 polymer man . 7404.573 1 . # # loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.details 1 1 UNP A70A_DROMA P67806 1 MKTLSLFLVLVCLLGLVQSWEWPWNRKPTKYPIPSPNPRDKWCRLNLGPAWGGRC 'Accessory gland-specific peptide 70A' 2 1 UNP A70A_DROSI P67807 1 MKTLSLFLVLVCLLGLVQSWEWPWNRKPTKYPIPSPNPRDKWCRLNLGPAWGGRC 'Accessory gland-specific peptide 70A' 3 1 UNP A0A0J9RUT5_DROSI A0A0J9RUT5 1 MKTLSLFLVLVCLLGLVQSWEWPWNRKPTKYPIPSPNPRDKWCRLNLGPAWGGRC 'Acp70A, isoform A' 4 1 UNP A0A6P8JSX6_DROMA A0A6P8JSX6 1 MKTLSLFLVLVCLLGLVQSWEWPWNRKPTKYPIPSPNPRDKWCRLNLGPAWGGRC 'Accessory gland-specific peptide 70A' # # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.seq_align_beg _struct_ref_seq.seq_align_end _struct_ref_seq.db_align_beg _struct_ref_seq.db_align_end 1 1 1 55 1 55 2 2 1 55 1 55 3 3 1 55 1 55 4 4 1 55 1 55 # # loop_ _ma_target_ref_db_details.target_entity_id _ma_target_ref_db_details.db_name _ma_target_ref_db_details.db_name_other_details _ma_target_ref_db_details.db_code _ma_target_ref_db_details.db_accession _ma_target_ref_db_details.seq_db_isoform _ma_target_ref_db_details.seq_db_align_begin _ma_target_ref_db_details.seq_db_align_end _ma_target_ref_db_details.ncbi_taxonomy_id _ma_target_ref_db_details.organism_scientific _ma_target_ref_db_details.seq_db_sequence_version_date _ma_target_ref_db_details.seq_db_sequence_checksum _ma_target_ref_db_details.is_primary 1 UNP . A70A_DROMA P67806 . 1 55 7226 'Drosophila mauritiana (Fruit fly)' 2004-10-11 E87397C3F196123D . 1 UNP . A70A_DROSI P67807 . 1 55 7240 'Drosophila simulans (Fruit fly)' 2004-10-11 E87397C3F196123D . 1 UNP . A0A0J9RUT5_DROSI A0A0J9RUT5 . 1 55 7240 'Drosophila simulans (Fruit fly)' 2015-10-14 E87397C3F196123D . 1 UNP . A0A6P8JSX6_DROMA A0A6P8JSX6 . 1 55 7226 'Drosophila mauritiana (Fruit fly)' 2020-12-02 E87397C3F196123D . # # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_strand_id _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can 1 polypeptide(L) no no A MKTLSLFLVLVCLLGLVQSWEWPWNRKPTKYPIPSPNPRDKWCRLNLGPAWGGRC MKTLSLFLVLVCLLGLVQSWEWPWNRKPTKYPIPSPNPRDKWCRLNLGPAWGGRC # # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET . 1 2 LYS . 1 3 THR . 1 4 LEU . 1 5 SER . 1 6 LEU . 1 7 PHE . 1 8 LEU . 1 9 VAL . 1 10 LEU . 1 11 VAL . 1 12 CYS . 1 13 LEU . 1 14 LEU . 1 15 GLY . 1 16 LEU . 1 17 VAL . 1 18 GLN . 1 19 SER . 1 20 TRP . 1 21 GLU . 1 22 TRP . 1 23 PRO . 1 24 TRP . 1 25 ASN . 1 26 ARG . 1 27 LYS . 1 28 PRO . 1 29 THR . 1 30 LYS . 1 31 TYR . 1 32 PRO . 1 33 ILE . 1 34 PRO . 1 35 SER . 1 36 PRO . 1 37 ASN . 1 38 PRO . 1 39 ARG . 1 40 ASP . 1 41 LYS . 1 42 TRP . 1 43 CYS . 1 44 ARG . 1 45 LEU . 1 46 ASN . 1 47 LEU . 1 48 GLY . 1 49 PRO . 1 50 ALA . 1 51 TRP . 1 52 GLY . 1 53 GLY . 1 54 ARG . 1 55 CYS . # # loop_ _struct_asym.id _struct_asym.entity_id _struct_asym.details A 1 . # # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 MET 1 ? ? ? A . A 1 2 LYS 2 ? ? ? A . A 1 3 THR 3 ? ? ? A . A 1 4 LEU 4 ? ? ? A . A 1 5 SER 5 5 SER SER A . A 1 6 LEU 6 6 LEU LEU A . A 1 7 PHE 7 7 PHE PHE A . A 1 8 LEU 8 8 LEU LEU A . A 1 9 VAL 9 9 VAL VAL A . A 1 10 LEU 10 10 LEU LEU A . A 1 11 VAL 11 11 VAL VAL A . A 1 12 CYS 12 12 CYS CYS A . A 1 13 LEU 13 13 LEU LEU A . A 1 14 LEU 14 14 LEU LEU A . A 1 15 GLY 15 15 GLY GLY A . A 1 16 LEU 16 16 LEU LEU A . A 1 17 VAL 17 17 VAL VAL A . A 1 18 GLN 18 18 GLN GLN A . A 1 19 SER 19 19 SER SER A . A 1 20 TRP 20 20 TRP TRP A . A 1 21 GLU 21 ? ? ? A . A 1 22 TRP 22 ? ? ? A . A 1 23 PRO 23 ? ? ? A . A 1 24 TRP 24 ? ? ? A . A 1 25 ASN 25 ? ? ? A . A 1 26 ARG 26 ? ? ? A . A 1 27 LYS 27 ? ? ? A . A 1 28 PRO 28 ? ? ? A . A 1 29 THR 29 ? ? ? A . A 1 30 LYS 30 ? ? ? A . A 1 31 TYR 31 ? ? ? A . A 1 32 PRO 32 ? ? ? A . A 1 33 ILE 33 ? ? ? A . A 1 34 PRO 34 ? ? ? A . A 1 35 SER 35 ? ? ? A . A 1 36 PRO 36 ? ? ? A . A 1 37 ASN 37 ? ? ? A . A 1 38 PRO 38 ? ? ? A . A 1 39 ARG 39 ? ? ? A . A 1 40 ASP 40 ? ? ? A . A 1 41 LYS 41 ? ? ? A . A 1 42 TRP 42 ? ? ? A . A 1 43 CYS 43 ? ? ? A . A 1 44 ARG 44 ? ? ? A . A 1 45 LEU 45 ? ? ? A . A 1 46 ASN 46 ? ? ? A . A 1 47 LEU 47 ? ? ? A . A 1 48 GLY 48 ? ? ? A . A 1 49 PRO 49 ? ? ? A . A 1 50 ALA 50 ? ? ? A . A 1 51 TRP 51 ? ? ? A . A 1 52 GLY 52 ? ? ? A . A 1 53 GLY 53 ? ? ? A . A 1 54 ARG 54 ? ? ? A . A 1 55 CYS 55 ? ? ? A . # # loop_ _ma_data.id _ma_data.name _ma_data.content_type _ma_data.content_type_other_details 1 'archaeal adhesion filament core {PDB ID=3j1r, label_asym_id=A, auth_asym_id=A, SMTL ID=3j1r.1.A}' 'template structure' . 2 . target . 3 'Target-template alignment by HHblits to 3j1r, label_asym_id=A' 'target-template alignment' . 4 'model 2' 'model coordinates' . 5 SMTL 'reference database' . 6 PDB 'reference database' . 7 'Template search output' other 'Results of the sequence search' # # loop_ _ma_data_group.ordinal_id _ma_data_group.group_id _ma_data_group.data_id 1 1 2 2 1 5 3 1 6 4 2 7 5 3 2 6 3 1 7 3 3 8 4 1 9 4 3 10 5 4 # # loop_ _ma_data_ref_db.data_id _ma_data_ref_db.name _ma_data_ref_db.location_url _ma_data_ref_db.version _ma_data_ref_db.release_date 5 SMTL https://swissmodel.expasy.org/templates/ . 2025-10-15 6 PDB https://www.wwpdb.org . 2025-10-10 # # loop_ _ma_target_entity.entity_id _ma_target_entity.data_id _ma_target_entity.origin 1 2 'reference database' # # loop_ _ma_target_entity_instance.asym_id _ma_target_entity_instance.entity_id _ma_target_entity_instance.details A 1 . # # loop_ _ma_template_trans_matrix.id _ma_template_trans_matrix.rot_matrix[1][1] _ma_template_trans_matrix.rot_matrix[2][1] _ma_template_trans_matrix.rot_matrix[3][1] _ma_template_trans_matrix.rot_matrix[1][2] _ma_template_trans_matrix.rot_matrix[2][2] _ma_template_trans_matrix.rot_matrix[3][2] _ma_template_trans_matrix.rot_matrix[1][3] _ma_template_trans_matrix.rot_matrix[2][3] _ma_template_trans_matrix.rot_matrix[3][3] _ma_template_trans_matrix.tr_vector[1] _ma_template_trans_matrix.tr_vector[2] _ma_template_trans_matrix.tr_vector[3] 1 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0 0 0 # # loop_ _ma_template_details.ordinal_id _ma_template_details.template_id _ma_template_details.template_origin _ma_template_details.template_entity_type _ma_template_details.template_trans_matrix_id _ma_template_details.template_data_id _ma_template_details.target_asym_id _ma_template_details.template_label_asym_id _ma_template_details.template_label_entity_id _ma_template_details.template_model_num _ma_template_details.template_auth_asym_id 1 1 'reference database' polymer 1 1 A A 1 1 A # # loop_ _ma_template_poly.template_id _ma_template_poly.seq_one_letter_code _ma_template_poly.seq_one_letter_code_can 1 VSPVIATLLLILIAVAAAVLLYTWVS VSPVIATLLLILIAVAAAVLLYTWVS # # loop_ _ma_template_poly_segment.id _ma_template_poly_segment.template_id _ma_template_poly_segment.residue_number_begin _ma_template_poly_segment.residue_number_end 1 1 9 24 # # loop_ _ma_template_ref_db_details.template_id _ma_template_ref_db_details.db_name _ma_template_ref_db_details.db_name_other_details _ma_template_ref_db_details.db_accession_code _ma_template_ref_db_details.db_version_date 1 PDB . 3j1r 2024-02-21 # # loop_ _ma_target_template_poly_mapping.id _ma_target_template_poly_mapping.template_segment_id _ma_target_template_poly_mapping.target_asym_id _ma_target_template_poly_mapping.target_seq_id_begin _ma_target_template_poly_mapping.target_seq_id_end 1 1 A 1 55 # # loop_ _ma_alignment_info.alignment_id _ma_alignment_info.data_id _ma_alignment_info.software_group_id _ma_alignment_info.alignment_length _ma_alignment_info.alignment_type _ma_alignment_info.alignment_mode 1 3 1 55 'target-template pairwise alignment' local # # loop_ _ma_alignment_details.ordinal_id _ma_alignment_details.alignment_id _ma_alignment_details.template_segment_id _ma_alignment_details.target_asym_id _ma_alignment_details.score_type _ma_alignment_details.score_type_other_details _ma_alignment_details.score_value _ma_alignment_details.percent_sequence_identity _ma_alignment_details.sequence_identity_denominator _ma_alignment_details.sequence_identity_denominator_other_details 1 1 1 A 'HHblits e-value' . 35.000 31.250 'Number of aligned residue pairs (not including the gaps)' . # # loop_ _ma_alignment.ordinal_id _ma_alignment.alignment_id _ma_alignment.target_template_flag _ma_alignment.sequence 1 1 1 MKTLSLFLVLVCLLGLVQSWEWPWNRKPTKYPIPSPNPRDKWCRLNLGPAWGGRC 2 1 2 ----LLILIAVAAAVLLYTW----------------------------------- # # loop_ _ma_protocol_step.ordinal_id _ma_protocol_step.protocol_id _ma_protocol_step.step_id _ma_protocol_step.method_type _ma_protocol_step.step_name _ma_protocol_step.details _ma_protocol_step.software_group_id _ma_protocol_step.input_data_group_id _ma_protocol_step.output_data_group_id 1 1 1 'template search' 'template search' 'SWISS-MODEL template search in PDB' 2 1 2 2 1 2 'template selection' 'template selection' 'Automatic template selection by SWISS-MODEL {QSQE=0.089}' 3 2 4 3 1 3 modeling 'homology modeling' 'SWISS-MODEL auto-model mode using ProMod3 on 3j1r.1, oligomeric state (monomer) as predicted' 4 3 5 # # loop_ _ma_model_list.ordinal_id _ma_model_list.model_name _ma_model_list.data_id _ma_model_list.model_type _ma_model_list.model_type_other_details 1 'model 2' 4 'Homology model' . # # loop_ _ma_model_group.id _ma_model_group.name _ma_model_group.details 1 . . # # loop_ _ma_model_group_link.group_id _ma_model_group_link.model_id 1 1 # # loop_ _atom_site.group_PDB _atom_site.id _atom_site.type_symbol _atom_site.label_atom_id _atom_site.label_alt_id _atom_site.label_comp_id _atom_site.label_seq_id _atom_site.auth_seq_id _atom_site.pdbx_PDB_ins_code _atom_site.label_asym_id _atom_site.Cartn_x _atom_site.Cartn_y _atom_site.Cartn_z _atom_site.occupancy _atom_site.label_entity_id _atom_site.auth_asym_id _atom_site.auth_comp_id _atom_site.B_iso_or_equiv _atom_site.pdbx_PDB_model_num ATOM 1 N N . SER 5 5 ? A 7.593 -7.315 -62.310 1 1 A SER 1.000 1 ATOM 2 C CA . SER 5 5 ? A 8.430 -8.504 -61.857 1 1 A SER 1.000 1 ATOM 3 C C . SER 5 5 ? A 9.613 -8.088 -61.002 1 1 A SER 1.000 1 ATOM 4 O O . SER 5 5 ? A 9.578 -8.291 -59.800 1 1 A SER 1.000 1 ATOM 5 C CB . SER 5 5 ? A 8.903 -9.406 -63.040 1 1 A SER 1.000 1 ATOM 6 O OG . SER 5 5 ? A 9.613 -10.541 -62.544 1 1 A SER 1.000 1 ATOM 7 N N . LEU 6 6 ? A 10.642 -7.404 -61.567 1 1 A LEU 1.000 1 ATOM 8 C CA . LEU 6 6 ? A 11.791 -6.880 -60.841 1 1 A LEU 1.000 1 ATOM 9 C C . LEU 6 6 ? A 11.435 -6.014 -59.634 1 1 A LEU 1.000 1 ATOM 10 O O . LEU 6 6 ? A 12.036 -6.139 -58.587 1 1 A LEU 1.000 1 ATOM 11 C CB . LEU 6 6 ? A 12.745 -6.103 -61.798 1 1 A LEU 1.000 1 ATOM 12 C CG . LEU 6 6 ? A 12.256 -4.727 -62.338 1 1 A LEU 1.000 1 ATOM 13 C CD1 . LEU 6 6 ? A 13.411 -4.014 -63.058 1 1 A LEU 1.000 1 ATOM 14 C CD2 . LEU 6 6 ? A 11.021 -4.764 -63.268 1 1 A LEU 1.000 1 ATOM 15 N N . PHE 7 7 ? A 10.368 -5.176 -59.722 1 1 A PHE 0.880 1 ATOM 16 C CA . PHE 7 7 ? A 9.840 -4.452 -58.579 1 1 A PHE 0.880 1 ATOM 17 C C . PHE 7 7 ? A 9.443 -5.368 -57.416 1 1 A PHE 0.880 1 ATOM 18 O O . PHE 7 7 ? A 9.835 -5.139 -56.290 1 1 A PHE 0.880 1 ATOM 19 C CB . PHE 7 7 ? A 8.642 -3.575 -59.041 1 1 A PHE 0.880 1 ATOM 20 C CG . PHE 7 7 ? A 8.145 -2.705 -57.916 1 1 A PHE 0.880 1 ATOM 21 C CD1 . PHE 7 7 ? A 7.033 -3.095 -57.149 1 1 A PHE 0.880 1 ATOM 22 C CD2 . PHE 7 7 ? A 8.831 -1.533 -57.566 1 1 A PHE 0.880 1 ATOM 23 C CE1 . PHE 7 7 ? A 6.593 -2.308 -56.079 1 1 A PHE 0.880 1 ATOM 24 C CE2 . PHE 7 7 ? A 8.389 -0.740 -56.499 1 1 A PHE 0.880 1 ATOM 25 C CZ . PHE 7 7 ? A 7.263 -1.121 -55.762 1 1 A PHE 0.880 1 ATOM 26 N N . LEU 8 8 ? A 8.729 -6.486 -57.678 1 1 A LEU 0.900 1 ATOM 27 C CA . LEU 8 8 ? A 8.377 -7.472 -56.669 1 1 A LEU 0.900 1 ATOM 28 C C . LEU 8 8 ? A 9.594 -8.124 -56.039 1 1 A LEU 0.900 1 ATOM 29 O O . LEU 8 8 ? A 9.639 -8.344 -54.836 1 1 A LEU 0.900 1 ATOM 30 C CB . LEU 8 8 ? A 7.487 -8.582 -57.276 1 1 A LEU 0.900 1 ATOM 31 C CG . LEU 8 8 ? A 6.136 -8.102 -57.844 1 1 A LEU 0.900 1 ATOM 32 C CD1 . LEU 8 8 ? A 5.409 -9.305 -58.467 1 1 A LEU 0.900 1 ATOM 33 C CD2 . LEU 8 8 ? A 5.261 -7.448 -56.759 1 1 A LEU 0.900 1 ATOM 34 N N . VAL 9 9 ? A 10.644 -8.391 -56.849 1 1 A VAL 0.950 1 ATOM 35 C CA . VAL 9 9 ? A 11.941 -8.840 -56.367 1 1 A VAL 0.950 1 ATOM 36 C C . VAL 9 9 ? A 12.548 -7.821 -55.413 1 1 A VAL 0.950 1 ATOM 37 O O . VAL 9 9 ? A 12.950 -8.185 -54.320 1 1 A VAL 0.950 1 ATOM 38 C CB . VAL 9 9 ? A 12.908 -9.133 -57.516 1 1 A VAL 0.950 1 ATOM 39 C CG1 . VAL 9 9 ? A 14.287 -9.585 -56.988 1 1 A VAL 0.950 1 ATOM 40 C CG2 . VAL 9 9 ? A 12.292 -10.216 -58.426 1 1 A VAL 0.950 1 ATOM 41 N N . LEU 10 10 ? A 12.528 -6.507 -55.758 1 1 A LEU 0.920 1 ATOM 42 C CA . LEU 10 10 ? A 13.005 -5.421 -54.910 1 1 A LEU 0.920 1 ATOM 43 C C . LEU 10 10 ? A 12.294 -5.390 -53.565 1 1 A LEU 0.920 1 ATOM 44 O O . LEU 10 10 ? A 12.933 -5.193 -52.539 1 1 A LEU 0.920 1 ATOM 45 C CB . LEU 10 10 ? A 12.866 -4.022 -55.590 1 1 A LEU 0.920 1 ATOM 46 C CG . LEU 10 10 ? A 13.699 -3.827 -56.878 1 1 A LEU 0.920 1 ATOM 47 C CD1 . LEU 10 10 ? A 13.297 -2.525 -57.600 1 1 A LEU 0.920 1 ATOM 48 C CD2 . LEU 10 10 ? A 15.213 -3.870 -56.607 1 1 A LEU 0.920 1 ATOM 49 N N . VAL 11 11 ? A 10.967 -5.644 -53.537 1 1 A VAL 0.930 1 ATOM 50 C CA . VAL 11 11 ? A 10.177 -5.784 -52.318 1 1 A VAL 0.930 1 ATOM 51 C C . VAL 11 11 ? A 10.538 -7.012 -51.504 1 1 A VAL 0.930 1 ATOM 52 O O . VAL 11 11 ? A 10.720 -6.938 -50.292 1 1 A VAL 0.930 1 ATOM 53 C CB . VAL 11 11 ? A 8.681 -5.888 -52.601 1 1 A VAL 0.930 1 ATOM 54 C CG1 . VAL 11 11 ? A 7.879 -5.921 -51.278 1 1 A VAL 0.930 1 ATOM 55 C CG2 . VAL 11 11 ? A 8.227 -4.683 -53.442 1 1 A VAL 0.930 1 ATOM 56 N N . CYS 12 12 ? A 10.668 -8.191 -52.153 1 1 A CYS 0.930 1 ATOM 57 C CA . CYS 12 12 ? A 11.060 -9.420 -51.487 1 1 A CYS 0.930 1 ATOM 58 C C . CYS 12 12 ? A 12.443 -9.307 -50.884 1 1 A CYS 0.930 1 ATOM 59 O O . CYS 12 12 ? A 12.634 -9.599 -49.712 1 1 A CYS 0.930 1 ATOM 60 C CB . CYS 12 12 ? A 11.017 -10.631 -52.457 1 1 A CYS 0.930 1 ATOM 61 S SG . CYS 12 12 ? A 9.322 -11.048 -52.970 1 1 A CYS 0.930 1 ATOM 62 N N . LEU 13 13 ? A 13.416 -8.767 -51.648 1 1 A LEU 0.930 1 ATOM 63 C CA . LEU 13 13 ? A 14.735 -8.434 -51.151 1 1 A LEU 0.930 1 ATOM 64 C C . LEU 13 13 ? A 14.696 -7.436 -50.016 1 1 A LEU 0.930 1 ATOM 65 O O . LEU 13 13 ? A 15.325 -7.648 -48.999 1 1 A LEU 0.930 1 ATOM 66 C CB . LEU 13 13 ? A 15.632 -7.859 -52.270 1 1 A LEU 0.930 1 ATOM 67 C CG . LEU 13 13 ? A 15.974 -8.875 -53.375 1 1 A LEU 0.930 1 ATOM 68 C CD1 . LEU 13 13 ? A 16.666 -8.144 -54.536 1 1 A LEU 0.930 1 ATOM 69 C CD2 . LEU 13 13 ? A 16.821 -10.053 -52.859 1 1 A LEU 0.930 1 ATOM 70 N N . LEU 14 14 ? A 13.885 -6.359 -50.126 1 1 A LEU 0.910 1 ATOM 71 C CA . LEU 14 14 ? A 13.702 -5.391 -49.064 1 1 A LEU 0.910 1 ATOM 72 C C . LEU 14 14 ? A 13.177 -6.014 -47.769 1 1 A LEU 0.910 1 ATOM 73 O O . LEU 14 14 ? A 13.639 -5.698 -46.678 1 1 A LEU 0.910 1 ATOM 74 C CB . LEU 14 14 ? A 12.744 -4.273 -49.549 1 1 A LEU 0.910 1 ATOM 75 C CG . LEU 14 14 ? A 12.565 -3.081 -48.595 1 1 A LEU 0.910 1 ATOM 76 C CD1 . LEU 14 14 ? A 13.888 -2.327 -48.364 1 1 A LEU 0.910 1 ATOM 77 C CD2 . LEU 14 14 ? A 11.478 -2.140 -49.146 1 1 A LEU 0.910 1 ATOM 78 N N . GLY 15 15 ? A 12.230 -6.972 -47.860 1 1 A GLY 0.910 1 ATOM 79 C CA . GLY 15 15 ? A 11.733 -7.733 -46.715 1 1 A GLY 0.910 1 ATOM 80 C C . GLY 15 15 ? A 12.752 -8.631 -46.043 1 1 A GLY 0.910 1 ATOM 81 O O . GLY 15 15 ? A 12.716 -8.810 -44.831 1 1 A GLY 0.910 1 ATOM 82 N N . LEU 16 16 ? A 13.729 -9.159 -46.814 1 1 A LEU 0.910 1 ATOM 83 C CA . LEU 16 16 ? A 14.885 -9.916 -46.337 1 1 A LEU 0.910 1 ATOM 84 C C . LEU 16 16 ? A 15.966 -9.032 -45.707 1 1 A LEU 0.910 1 ATOM 85 O O . LEU 16 16 ? A 16.959 -9.534 -45.188 1 1 A LEU 0.910 1 ATOM 86 C CB . LEU 16 16 ? A 15.561 -10.727 -47.485 1 1 A LEU 0.910 1 ATOM 87 C CG . LEU 16 16 ? A 14.665 -11.774 -48.187 1 1 A LEU 0.910 1 ATOM 88 C CD1 . LEU 16 16 ? A 15.404 -12.400 -49.387 1 1 A LEU 0.910 1 ATOM 89 C CD2 . LEU 16 16 ? A 14.118 -12.853 -47.232 1 1 A LEU 0.910 1 ATOM 90 N N . VAL 17 17 ? A 15.790 -7.692 -45.764 1 1 A VAL 0.920 1 ATOM 91 C CA . VAL 17 17 ? A 16.672 -6.695 -45.174 1 1 A VAL 0.920 1 ATOM 92 C C . VAL 17 17 ? A 16.011 -6.042 -43.976 1 1 A VAL 0.920 1 ATOM 93 O O . VAL 17 17 ? A 16.669 -5.734 -42.998 1 1 A VAL 0.920 1 ATOM 94 C CB . VAL 17 17 ? A 16.994 -5.584 -46.172 1 1 A VAL 0.920 1 ATOM 95 C CG1 . VAL 17 17 ? A 17.857 -4.468 -45.535 1 1 A VAL 0.920 1 ATOM 96 C CG2 . VAL 17 17 ? A 17.756 -6.204 -47.355 1 1 A VAL 0.920 1 ATOM 97 N N . GLN 18 18 ? A 14.672 -5.846 -43.987 1 1 A GLN 0.870 1 ATOM 98 C CA . GLN 18 18 ? A 13.951 -5.276 -42.856 1 1 A GLN 0.870 1 ATOM 99 C C . GLN 18 18 ? A 13.818 -6.233 -41.675 1 1 A GLN 0.870 1 ATOM 100 O O . GLN 18 18 ? A 13.418 -5.839 -40.586 1 1 A GLN 0.870 1 ATOM 101 C CB . GLN 18 18 ? A 12.516 -4.863 -43.277 1 1 A GLN 0.870 1 ATOM 102 C CG . GLN 18 18 ? A 12.463 -3.679 -44.270 1 1 A GLN 0.870 1 ATOM 103 C CD . GLN 18 18 ? A 11.023 -3.391 -44.703 1 1 A GLN 0.870 1 ATOM 104 O OE1 . GLN 18 18 ? A 10.053 -3.977 -44.253 1 1 A GLN 0.870 1 ATOM 105 N NE2 . GLN 18 18 ? A 10.880 -2.433 -45.654 1 1 A GLN 0.870 1 ATOM 106 N N . SER 19 19 ? A 14.116 -7.527 -41.910 1 1 A SER 0.970 1 ATOM 107 C CA . SER 19 19 ? A 14.270 -8.554 -40.898 1 1 A SER 0.970 1 ATOM 108 C C . SER 19 19 ? A 15.673 -8.660 -40.301 1 1 A SER 0.970 1 ATOM 109 O O . SER 19 19 ? A 15.814 -9.210 -39.212 1 1 A SER 0.970 1 ATOM 110 C CB . SER 19 19 ? A 13.917 -9.940 -41.514 1 1 A SER 0.970 1 ATOM 111 O OG . SER 19 19 ? A 14.787 -10.303 -42.592 1 1 A SER 0.970 1 ATOM 112 N N . TRP 20 20 ? A 16.706 -8.154 -41.017 1 1 A TRP 0.780 1 ATOM 113 C CA . TRP 20 20 ? A 18.096 -8.085 -40.603 1 1 A TRP 0.780 1 ATOM 114 C C . TRP 20 20 ? A 18.385 -6.833 -39.718 1 1 A TRP 0.780 1 ATOM 115 O O . TRP 20 20 ? A 17.498 -5.947 -39.587 1 1 A TRP 0.780 1 ATOM 116 C CB . TRP 20 20 ? A 18.999 -8.112 -41.885 1 1 A TRP 0.780 1 ATOM 117 C CG . TRP 20 20 ? A 20.491 -8.311 -41.644 1 1 A TRP 0.780 1 ATOM 118 C CD1 . TRP 20 20 ? A 21.132 -9.402 -41.130 1 1 A TRP 0.780 1 ATOM 119 C CD2 . TRP 20 20 ? A 21.508 -7.297 -41.804 1 1 A TRP 0.780 1 ATOM 120 N NE1 . TRP 20 20 ? A 22.487 -9.152 -40.968 1 1 A TRP 0.780 1 ATOM 121 C CE2 . TRP 20 20 ? A 22.718 -7.846 -41.370 1 1 A TRP 0.780 1 ATOM 122 C CE3 . TRP 20 20 ? A 21.424 -5.978 -42.243 1 1 A TRP 0.780 1 ATOM 123 C CZ2 . TRP 20 20 ? A 23.892 -7.087 -41.365 1 1 A TRP 0.780 1 ATOM 124 C CZ3 . TRP 20 20 ? A 22.603 -5.215 -42.257 1 1 A TRP 0.780 1 ATOM 125 C CH2 . TRP 20 20 ? A 23.819 -5.759 -41.826 1 1 A TRP 0.780 1 ATOM 126 O OXT . TRP 20 20 ? A 19.502 -6.775 -39.134 1 1 A TRP 0.780 1 # # loop_ _atom_type.symbol C N O S # # loop_ _ma_qa_metric.id _ma_qa_metric.name _ma_qa_metric.description _ma_qa_metric.type _ma_qa_metric.mode _ma_qa_metric.type_other_details _ma_qa_metric.software_group_id 1 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].' 'pLDDT all-atom in [0,1]' local . 5 2 QMEANDisCo 'Predicted accuracy according to all-atom lDDT in [0,1].' 'pLDDT all-atom in [0,1]' global . 5 3 GMQE 'Global Model Quality Estimate of the model accuracy, calculated by SWISS-MODEL.' 'normalized score' global . 6 # # loop_ _ma_qa_metric_global.ordinal_id _ma_qa_metric_global.model_id _ma_qa_metric_global.metric_id _ma_qa_metric_global.metric_value 1 1 2 0.919 2 1 3 0.172 # # loop_ _ma_qa_metric_local.ordinal_id _ma_qa_metric_local.model_id _ma_qa_metric_local.label_asym_id _ma_qa_metric_local.label_seq_id _ma_qa_metric_local.label_comp_id _ma_qa_metric_local.metric_id _ma_qa_metric_local.metric_value 1 1 A 5 SER 1 1.000 2 1 A 6 LEU 1 1.000 3 1 A 7 PHE 1 0.880 4 1 A 8 LEU 1 0.900 5 1 A 9 VAL 1 0.950 6 1 A 10 LEU 1 0.920 7 1 A 11 VAL 1 0.930 8 1 A 12 CYS 1 0.930 9 1 A 13 LEU 1 0.930 10 1 A 14 LEU 1 0.910 11 1 A 15 GLY 1 0.910 12 1 A 16 LEU 1 0.910 13 1 A 17 VAL 1 0.920 14 1 A 18 GLN 1 0.870 15 1 A 19 SER 1 0.970 16 1 A 20 TRP 1 0.780 #