>tr|A0ABW0QCK4|A0ABW0QCK4_9BURK 50S ribosomal protein L34 OS=Polaromonas jejuensis GN=rpmH MKRTYQPSKVKRARTHGFLTRMKTRGGRAVIAARRAKGRKRLAV