Q9HB55 (CP343_HUMAN) Homo sapiens (Human)

Cytochrome P450 3A43 UniProtKBInterProSTRINGInteractive Modelling

503 aa; Sequence (Fasta) ; (Isoform 2; Isoform 3; Isoform 4; Isoform 6; )

Sequence Features

 442Iron (heme axial ligand).
 27T -> A (in dbSNP:rs45558032). VAR_048449 dbSNP
 145M -> I (in dbSNP:rs45450092). VAR_048450 dbSNP
 275M -> I (in dbSNP:rs45621431). VAR_048451 dbSNP
 340P -> A (in allele CYP3A43*3; dbSNP:rs680055). VAR_018052 dbSNP
 25-88YGTHSHKLFKKLGIPGPTPLPFLGTILFYLRGLWNFDRECN EKYGEMWGLYEGQQPMLVIMDPD -> LGPIHINFLRSWEF LGQPLCLFWELFCSTLGVFGILTENVMKNTEKCGGCMRGNS PCWSSWIPT (in allele CYP3A43*2). VAR_018050
 89-503Missing (in allele CYP3A43*2). VAR_018051
 39-493Cytochrome P450
IPR001128PF00067

Sequence Alignments

Homology models

Oligo-stateLigandsQMEANTemplateRangeSeq id (%)ReportDownloadAssess
homo-2-mer 0.195vcc.1.B29-496
75.73

Homology models built on isoform sequence

Isoform #Oligo-stateLigandsQMEANTemplateRangeSeq id (%)ReportDownloadAssess
2homo-2-mer0.185vcc.1.B29-497
75.73
3homo-2-mer0.335vcc.1.B29-418
75.38
4monomer0.206mjm.1.A26-201
72.47
6homo-2-mer-1.455vcc.1.B29-386
68.77