Start a New Modelling Project

Target Sequence:
(Format must be Fasta, Clustal, Promod,
plain string, or a valid UniProtKB AC)
Upload Target Sequence File...
Project Title:
Email:
By using the SWISS-MODEL server, you agree to comply with the following terms of use and to cite the corresponding articles.
I have read the terms of use, and hereby state that I am (Please select)

When a protein amino acid sequence is pasted into the textarea, the input text is immediately validated and if valid replaced with an interactive sequence view.

The format of the sequence must be either Fasta, Clustal or raw sequence.

You may also upload the sequence as a file.

As an example, we will paste the sequence:

>Target
SNAGNSTTSDKGTEEATTSAFDVMSQFNEIGVSYPLTVTDQAGRTVTFEKAPEKIASSYYISTSLLLALGLQ
DKLVGIEAKANTRNIYKLAAPAIVSLPNMGTAKEFNTEACVAATPDVVFLPMKLKKTADTLESLGIKAVVVN
PEDQSLLEECITLVGKITNNAGRAEALNNSIKTFLADNKTNVSGGNTPSVYLAGNSSVLSTAGSKMYQNTLL
TNAGGKNVASELTDTYWANVSYEQILAWNPDYIVIAADATYTVDDILNDANLAGCNAVKNKNVVKLPNNIEA
WDSPVPGSFLGSIYIASVLHPEKVTKDFYETCVTKFYESFYGFTPAK

If the desired template for modelling is known and is found in the SMTL, an alignment of target-template in either Fasta or Clustal format may be used to start modelling without the need for a template search.

1: Preferably the first sequence in alignment should be the target protein amino acid sequence.

2: Preferably the template sequence(s) are named as per PDB id format. eg "1CRN", "1CRNA" or "1CRN_A".

3: If a valid target-template alignment is identified by SWISS-MODEL, the alignment will be displayed. Otherwise, please specify the target and/or template from a drop down list which will be displayed.

4: It is possible there are more than one biounits for your template, if so you will see several alignments from which you must make a selection to build a model.

As an example we will paste the following target/template alignment:

>THN_DENCL
KSCCPTTAARNQYNICRLPGTPRPVCAALSGCKIISGTGCPPGYRH
>1crnA
TTCCPSIVARSNFNVCRLPGTPEAICATYTGCIIIPGATCPGDYAN

When a UniProt AC is pasted in the textarea, the input is immediately validated and replaced with an interactive sequence view.

As an example, we will paste the UniProt AC P61853


It is possible to specify the structure to be used as modelling template by uploading a file in PDB format (*) with coordinates of the template structure.

1: Enter the target protein amino acid sequence as normal in the textarea.

Example:

>sp|P61851|SODC_DROME
MVVKAVCVINGDAKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSG
PHFNPYGKEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHA
DADDLGQGGHELSKSTGNAGARIGCGVIGIAKV

2: Upload your template file - please make sure that this file contains only a single protein chain, and does not contain chemically modified amino acids, hetero atoms, ligands, etc.

For example, after entering the target sequence above, download this file, then click the "Add Template File" button (or simply drag the file onto the button)

The program DeepView (Swiss-PdbViewer, Guex et al.) can be used to generate, display, analyze and manipulate modelling project files for the SWISS-MODEL workspace.

Project files contain the superposed template structures, and the alignment between the target and template. The user has therefor full control over essential modelling parameters, i.e. the choice of template structures, the correct alignment of residues, and the placement of insertions and deletions in the context of the three-dimensional structure.

Here is an example Deepview Project file.

DeepView can be downloaded from the DeepView Home website.


You are currently not logged in - to take advantage of the workspace, please log in or create an account.
(There is no requirement to create an account to use any part of SWISS-MODEL, however you will gain the benefit of seeing a list of your previous modelling projects here.)