A0A1D8PQ86 (ALS9_CANAL) Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Agglutinin-like protein 9 UniProtKBInterProSTRINGInteractive Modelling

1890 aa; Sequence (Fasta)

Sequence Features

 39V -> A (in allele ALS9-2).
 49T -> N (in allele ALS9-2).
 63A -> P (in allele ALS9-2).
 71M -> L (in allele ALS9-2).
 80S -> T (in allele ALS9-2).
 146T -> A (in allele ALS9-2).
 161M -> T (in allele ALS9-1).
 196A -> L (in allele ALS9-2).
 202S -> V (in allele ALS9-2).
 218T -> A (in allele ALS9-2).
 220Q -> N (in allele ALS9-2).
 229I -> V (in allele ALS9-2).
 250T -> S (in allele ALS9-2).
 298K -> E (in allele ALS9-2).
 312W -> T (in allele ALS9-1).
 322N -> D (in allele ALS9-2).
 325I -> V (in allele ALS9-2).
 331K -> R (in allele ALS9-2).
 335A -> D (in allele ALS9-2).
 348T -> S (in allele ALS9-2).
 357V -> I (in allele ALS9-2).
 380F -> L (in allele ALS9-2).
 382A -> G (in allele ALS9-2).
 400T -> A (in allele ALS9-2).
 404T -> N (in allele ALS9-2).
 410V -> I (in allele ALS9-2).
 417S -> T (in allele ALS9-2).
 423I -> V (in allele ALS9-1).
 453V -> I (in allele ALS9-2).
 489I -> V (in allele ALS9-1).
 501V -> I (in allele ALS9-1).
 525V -> I (in allele ALS9-2).
 561I -> V (in allele ALS9-1).
 577Y -> H (in allele ALS9-2).
 607V -> F (in allele ALS9-1).
 609I -> V (in allele ALS9-1).
 633I -> V (in allele ALS9-1).
 645V -> I (in allele ALS9-1).
 669I -> V (in allele ALS9-1).
 679V -> I (in allele ALS9-1).
 682K -> M (in allele ALS9-1).
 685Y -> F (in allele ALS9-2).
 712T -> R (in allele ALS9-1).
 718K -> M (in allele ALS9-1).
 753V -> I (in allele ALS9-2).
 781P -> L (in allele ALS9-2).
 789V -> I (in allele ALS9-1).
 813I -> V (in allele ALS9-1).
 820T -> R (in allele ALS9-1).
 826K -> M (in allele ALS9-1).
 849I -> V (in allele ALS9-1).
 882T -> S (in allele ALS9-1).
 885I -> V (in allele ALS9-1).
 921I -> V (in allele ALS9-1).
 944T -> N (in allele ALS9-2).
 948S -> Y (in allele ALS9-2).
 993V -> I (in allele ALS9-2).
 1029V -> I (in allele ALS9-2).
 1045Y -> H (in allele ALS9-2).
 1065V -> I (in allele ALS9-2).
 1077I -> V (in allele ALS9-2).
 1081Y -> H (in allele ALS9-2).
 1149A -> T (in allele ALS9-2).
 1170L -> F (in allele ALS9-2).
 1238L -> S (in allele ALS9-2).
 1242N -> D (in allele ALS9-2).
 1301M -> V (in allele ALS9-2).
 1308S -> N (in allele ALS9-2).
 1429M -> L (in allele ALS9-2).
 1488T -> TTAESIATKTIVSETPVTKVLSSKSLAANASPSEPT SKKE (in allele ALS9-2).
 1799D -> G (in allele ALS9-2).
 1859K -> N (in allele ALS9-2).
 1861V -> I (in allele ALS9-2).
 1875L -> H (in allele ALS9-2).
 73-150
 96-112
 205-297
 226-255
 6-11LLLLLY -> ILLFIS (in allele ALS9-2).
 28-42DSLTWTRSVEYVYKG -> NSLTWANAANYGYQT (in allele ALS9-1).
 122-124DKA -> ARV (in allele ALS9-2).
 132-133IT -> FS (in allele ALS9-1).
 166-190KISTTVDFDASPVSPSGYITSSRII -> EISTSVDFQASP ISSSGYIASARVV (in allele ALS9-1).
 256-265SSSGIIVEYE -> TSTSITVEFQ (in allele ALS9- 2).
 281-286SENVEQ -> AENIDK (in allele ALS9-2).
 371-374IGIS -> VGVT (in allele ALS9-1).
 429-470QIPSPDPTTTITEFWSESFASTTTVTNPPDGTNSVIIKEPY N -> ELPSPA (in allele ALS9-1).
 789-932Missing (in allele ALS9-2).
 1108-1134KTFYSSEAQSSLEIDSSNTFMTSISVS -> TIFHSSEPHY SSDFDSSDSFVTLISVT (in allele ALS9-2).
 1155-1164ISSYSLSTSF -> LSSYTWSSGL (in allele ALS9- 2).
 1180-1183SSPS -> NLPT (in allele ALS9-2).
 1189-1227MYSSVTSAVTSIDNDREVPTSTTTYLHSKLYSESISTVI -> VYSSTASAVASTDGDSVVPSSTNLVTQSISSSETYCID ISGCSSVRQSSSVMVTPSNSGRIIISDSAYLTTTYSHSESD LESIVTVV (in allele ALS9-2).
 1248-1257STVSEESLHY -> TTVSDDNSYS (in allele ALS9- 2).
 53-297Agglutinin-like protein, N-terminal
IPR024672PF11766
 400-431Agglutinin-like protein repeat
IPR008440PF05792
 437-468Agglutinin-like protein repeat
IPR008440PF05792
 473-504Agglutinin-like protein repeat
IPR008440PF05792
 509-540Agglutinin-like protein repeat
IPR008440PF05792
 545-576Agglutinin-like protein repeat
IPR008440PF05792
 581-612Agglutinin-like protein repeat
IPR008440PF05792
 617-648Agglutinin-like protein repeat
IPR008440PF05792
 653-684Agglutinin-like protein repeat
IPR008440PF05792
 689-720Agglutinin-like protein repeat
IPR008440PF05792
 725-756Agglutinin-like protein repeat
IPR008440PF05792
 761-792Agglutinin-like protein repeat
IPR008440PF05792
 797-828Agglutinin-like protein repeat
IPR008440PF05792
 833-864Agglutinin-like protein repeat
IPR008440PF05792
 869-900Agglutinin-like protein repeat
IPR008440PF05792
 905-936Agglutinin-like protein repeat
IPR008440PF05792
 941-972Agglutinin-like protein repeat
IPR008440PF05792
 977-1008Agglutinin-like protein repeat
IPR008440PF05792
 1013-1044Agglutinin-like protein repeat
IPR008440PF05792
 1049-1080Agglutinin-like protein repeat
IPR008440PF05792

Sequence Alignments

Experimental structures

DescriptionOligo-stateLigandsStructureRangeDownloadAssess
'Structure of N-terminal domain of Candida albicans Als9-2 in complex with human fibrinogen gamma... Heteromer
P02679;
2y7l18-328
Structure of N-terminal domain of Candida albicans Als9-2 G299W mutantmonomer 2ylh18-328
Structure of N-terminal domain of Candida albicans als9-2 - G299W mutantmonomer 2y7o18-328
Structure of N-terminal domain of Candida albicans als9-2 - Apo Formmonomer 2y7n18-328
Structure of N-terminal domain of Candida albicans als9-2 (Pt derivative)monomer 2y7m18-316