Q02928 (CP4AB_HUMAN) Homo sapiens (Human)

Cytochrome P450 4A11 UniProtKBInterProSTRINGInteractive Modelling

519 aa; Sequence (Fasta) ; (Isoform 2; )

Molecule Processing
Cytochrome P450 4A11

Sequence Features

 457Iron (heme axial ligand)
 226N -> S (in dbSNP:rs12759923) VAR_048452 dbSNP
 353S -> G (in dbSNP:rs3899049) VAR_044377 dbSNP
 434F -> S (associated with hypertension; significantly reduced arachidonic acid and lauric acid metabolizing activity; dbSNP:rs1126742) VAR_019160 dbSNP
 500-519NGIHLRLRRLPNPCEDKDQL -> MESTCVSGGSLTLVKTRTSFEGLHLPSC LPDPRFCPLPVCPYPVFCLPTFPSSHLPAVPQSACPSLSHLSPGLPTCLSTCLLPTCIS CWEKS (in CYP4A11V) VAR_001257
 52-502Cytochrome P450
IPR001128PF00067

Sequence Alignments

Homology models

Oligo-stateLigandsQMEANTemplateRangeSeq id (%)DownloadAssess
monomer -2.276c94.1.A47-509
55.41

Homology models built on isoform sequence

Isoform #Oligo-stateLigandsQMEANTemplateRangeSeq id (%)ReportDownloadAssess
2monomer-2.826c94.1.A47-355
51.95