Q5A8T7 (ALS5_CANAL) Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Agglutinin-like protein 5 UniProtKBInterProInteractive Modelling

1347 aa; Sequence (Fasta)

Molecule Processing
Agglutinin-like protein 5

Sequence Features

 2I -> L (in allele ALS5-2)
 311K -> R (in allele ALS5-2)
 406E -> K (in allele ALS5-2)
 481S -> SESYATTETITTGPLGTDSVIIKEPHNPTVTTTVFWS (in allele ALS5-1)
 492N -> T (in allele ALS5-1)
 495E -> L (in allele ALS5-1)
 514E -> K (in allele ALS5-1)
 526V -> I (in allele ALS5-1)
 539K -> R (in allele ALS5-1)
 542H -> Y (in allele ALS5-2)
 1167A -> T (in allele ALS5-2)
 1202T -> N (in allele ALS5-2)
 1271N -> S (in allele ALS5-2)
 1273L -> S (in allele ALS5-2)
 1278S -> L (in allele ALS5-2)
 1283M -> T (in allele ALS5-2)
 1291I -> M (in allele ALS5-2)
 73-150
 96-112
 205-298
 227-256
 502-503VR -> IK (in allele ALS5-1)
 1267-1269AQV -> SEA (in allele ALS5-1)
 53-298Agglutinin-like protein, N-terminal
IPR024672PF11766
 365-396Agglutinin-like protein repeat
IPR008440PF05792
 401-432Agglutinin-like protein repeat
IPR008440PF05792
 438-469Agglutinin-like protein repeat
IPR008440PF05792
 474-505Agglutinin-like protein repeat
IPR008440PF05792
 510-541Agglutinin-like protein repeat
IPR008440PF05792
 546-577Agglutinin-like protein repeat
IPR008440PF05792

Sequence Alignments

Homology models

Oligo-stateLigandsQMEANTemplateRangeSeq id (%)DownloadAssess
monomer -1.072y7n.1.A18-327
66.02