Q6PHS9 (CA2D2_MOUSE) Mus musculus (Mouse)

Voltage-dependent calcium channel subunit alpha-2/delta-2 UniProtKBInterProSTRINGInteractive Modelling

1154 aa; Sequence (Fasta) ; (Isoform 2; Isoform 3; Isoform 4; Isoform 5; Isoform 6; ) Identical sequences: Mus musculus: A0A411ACX9

Molecule Processing
Voltage-dependent calcium channel subunit alpha-2-2
Voltage-dependent calcium channel subunit delta-2

Sequence Features

Add
 300Divalent metal cation
 302Divalent metal cation
 304Divalent metal cation
 99E -> EIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALK (in du; variant allele entla)
 1117-1137Helical
 446-1101Interchain (between alpha-2-2 and delta-2 chains)
 144-268VWA N-terminal
IPR013608PF08399
 294-460von Willebrand factor, type A
IPR002035PF00092
 672-1114Voltage-dependent calcium channel, alpha-2/delta subunit, conserved region
IPR013680PF08473

Sequence Alignments

Homology models

Oligo-stateQMEANTemplateRangeSeq id (%)Ligands
monomer -2.95 7jpk.1.C67-1113
54.09
Assess

Homology models built on isoform sequence

IsoformOligo-stateLigandsQMEANTemplateRangeSeq id (%)
Isoform 2monomer-3.256jp5.1.C67-1107
54.65
Assess
Isoform 3monomer-2.667jpk.1.C67-1115
54.00
Assess
Isoform 4monomer-3.246jp5.1.C67-1106
54.65
Assess
Isoform 5monomer-3.206jp5.1.C67-1109
54.55
Assess
Isoform 6monomer-2.557jpk.1.C67-1116
54.00
Assess