Q7Z2X4 (PCLI1_HUMAN) Homo sapiens (Human)

PTB-containing, cubilin and LRP1-interacting protein UniProtKBInterProSTRINGInteractive Modelling

250 aa; Sequence (Fasta) ; (Isoform 2; Isoform 3; Isoform 4; )

Sequence Features

Add
 43T -> THFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHS GCK (in variant with duplicated exon 2) VAR_030361
 92-240PTB/PI domain
IPR006020PF14719

Sequence Alignments

Homology models

Oligo-stateQMEANTemplateRangeSeq id (%)Ligands
monomer -2.33 3so6.1.A89-229
18.46
Assess

Homology models built on isoform sequence

IsoformOligo-stateLigandsQMEANTemplateRangeSeq id (%)
Isoform 2monomer-2.543so6.1.A86-227
18.32
Assess
Isoform 3monomer-1.795njk.1.A5-146
17.04
Assess
Isoform 4monomer-2.533so6.1.A55-196
18.32
Assess