Q96PY0 (K1908_HUMAN) Homo sapiens (Human)

Putative uncharacterized protein PSMG3-AS1 UniProtKBInterProInteractive Modelling

264 aa; Sequence (Fasta)

Sequence Features

 264T -> TRWGRHHCPFSKVRKQRLREVQQLLPQLLRCRTAVPGVPELSLPEPS APALLSEPWPSQSKPGSGCSEALGLVNPSCLGPGPPPGGDPEGCS (in dbSNP:rs7800178) VAR_044007 dbSNP

Sequence Alignments

Homology models

Oligo-stateLigandsQMEANTemplateRangeSeq id (%)DownloadAssess
monomer -1.785t13.1.A169-194
34.62