All Projects

Projects created before 2024-01-08 are available to browse. Unfortunately templates originating from AlphaFold Database (AFDB) will fail for model building.

Please start a new template search to build models based on AFDB templates.

ORF6 protein (ORF6) | P0DTC6

Created: May 5, 2023 at 21:34

Template Results

No templates were found matching your target sequence.
However, 12 templates of low quality were found, you can see them in HTML or text format. Please see the search logs

MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID