All Projects

ORF6 protein (ORF6) | P0DTC6

Created: Nov. 10, 2022 at 10:18

Template Results

No templates were found matching your target sequence.
However, 11 templates of low quality were found, you can see them in HTML or text format. Please see the search logs

MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID