Projects created before 2024-01-08 are available to browse. Unfortunately templates originating from AlphaFold Database (AFDB) will fail for model building.
Please start a new template search to build models based on AFDB templates.
ORF10 protein | A0A663DJA2
Created: May 5, 2023 at 21:33
Template Results
No templates were found matching your target sequence.
However, 9 templates of low quality were found, you can see them in HTML or text format. Please see the search logs
MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT
However, 9 templates of low quality were found, you can see them in HTML or text format. Please see the search logs
MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT
