Due to a high load of modelling projects, the rate of submission via the website has been reduced.
For a much higher submission rate, please use the Modelling API.

 All Projects

Projects created before 2024-01-08 are available to browse. Unfortunately templates originating from AlphaFold Database (AFDB) will fail for model building.

Please start a new template search to build models based on AFDB templates.

ORF10 protein | A0A663DJA2

Created: May 5, 2023 at 21:33

Template Results

No templates were found matching your target sequence.
However, 9 templates of low quality were found, you can see them in HTML or text format. Please see the search logs

MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT