All Projects

ORF10 protein | A0A663DJA2

Created: Dec. 14, 2022 at 09:36

Template Results

No templates were found matching your target sequence.
However, 9 templates of low quality were found, you can see them in HTML or text format. Please see the search logs

MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT