All Projects

ORF10 protein | YP_009725255.1 | A0A663DJA

Created: Feb. 10, 2020 at 16:50

Template Results

No templates were found matching your target sequence. Please see the search logs

MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT