All Projects

ORF10 protein | A0A663DJA2

Created: Jan. 13, 2021 at 08:06

Template Results

No templates were found matching your target sequence.
However, 10 templates of low quality were found, you can see them in HTML or text format. Please see the search logs

MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT