All Projects

Y14_SARS2 P0DTD3 Uncharacterized protein 14

Created: May 27, 2020 at 20:46

Template Results

No templates were found matching your target sequence.
However, 2 templates of low quality were found, you can see them in HTML or text format. Please see the search logs

MLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD