Protein non-structural 7b (ns7b) | YP_009725296.1 | P0DTD8
Created: Feb. 10, 2020 at 16:46
Template Results
No templates were found matching your target sequence.
However, 1 template of low quality was found, you can see it in HTML or text format. Please see the search logs
MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA
However, 1 template of low quality was found, you can see it in HTML or text format. Please see the search logs
MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA