All Projects

Protein non-structural 7b (ns7b) | YP_009725296.1 | P0DTD8

Created: Feb. 10, 2020 at 16:46

Template Results

No templates were found matching your target sequence.
However, 1 template of low quality was found, you can see it in HTML or text format. Please see the search logs

MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA