P0A7V8 (RS4_ECOLI) Escherichia coli (strain K12)

30S ribosomal protein S4 UniProtKBInterProSTRINGSTRINGInteractive Modelling

206 aa; Sequence (Fasta) 204 identical sequences

Sequence Features

 51Y -> D (in rpsD101; suppresses a temperature- sensitive mutant of release factor 1, R137P. Not a ram mutation)
 170-206Missing (in rpsD16; suppresses streptomycin dependence in protein S12. A ram mutation)
 177-206KMEGTFKRKPERSDLSADINEHLIVELYSK -> GRYV (in rpsD12; suppresses streptomycin dependence in protein S12. A ram mutation)
 179-206EGTFKRKPERSDLSADINEHLIVELYSK -> ARYV (in rpsD14; suppresses streptomycin dependence in protein S12. A ram mutation)
 3-95Ribosomal protein S4/S9, N-terminal
 97-143RNA-binding S4 domain

Sequence Alignments

Experimental structures

High-resolution structure of the Escherichia coli ribosome Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
263×MG;PG4; 14×MPD; 16×PUT;ZN; 11×PEG;SPD;1PE;PGE;ACY; 12×EDO;GUN;TRS;4ybb2-206
Crystal structure of the E. coli ribosome bound to flopristin and linopristin. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q5SLP7;
Structure of the WT E coli ribosome bound to tetracycline Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
267×MG;PG4; 14×MPD; 16×PUT;TAC;ZN; 11×PEG; 12×EDO;PGE;SPD;1PE;ACY;GUN;TRS;5j5b2-206
Crystal structure of the E. coli ribosome bound to dalfopristin and quinupristin. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q5SLP7;
Control of ribosomal subunit rotation by elongation factor G Heteromer
P02358; P02359; P02413; P0A6M8; P0A7J3; P0A7J7; P0A7K2; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Crystal structure of the E. coli ribosome bound to dalfopristin. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q5SLP7;
Crystal structure of the E. coli ribosome bound to flopristin. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q5SLP7;
Crystal structure of the E. coli ribosome bound to virginiamycin M1. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q5SLP7;
Control of ribosomal subunit rotation by elongation factor G Heteromer
P02358; P02359; P02413; P0A6M8; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Crystal structure of the E. coli ribosome bound to quinupristin. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q5SLP7;
Structure of the Wild-type 70S E coli ribosome bound to Tigecycline Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
267×MG;PG4; 14×MPD; 16×PUT;T1C;ZN; 11×PEG; 12×EDO;PGE;SPD;1PE;ACY;GUN;TRS;5j912-206
4,5-linked aminoglycoside antibiotics regulate the bacterial ribosome by targeting dynamic conforma… Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0A805; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q5SLP7;
Structures of the bacterial ribosome in classical and hybrid states of tRNA binding Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0A805; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of the 70S E coli ribosome with the U1052G mutation in the 16S rRNA bound to tetracycline Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
268×MG;PG4; 14×MPD; 16×PUT;TAC;ZN; 11×PEG; 12×EDO;PGE;SPD;1PE;ACY;GUN;TRS;5j7l2-206
Crystal structure of the E. coli ribosome bound to linopristin. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q5SLP7;
Structure of the Escherichia coli ribosome with the U1052G mutation in the 16S rRNA Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
267×MG;PG4; 14×MPD; 16×PUT;ZN; 11×PEG; 12×EDO;PGE;SPD;1PE;ACY;GUN;TRS;5jc92-206
Crystal structure of the E. coli ribosome bound to negamycin. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q5SLP7;
Crystal structure of the E. coli ribosome bound to erythromycin. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Crystal structure of the E. coli ribosome bound to CEM-101 Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of the E coli 70S ribosome with the U1052G mutation in 16S rRNA bound to tigecycline Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
268×MG;PG4; 14×MPD; 16×PUT;T1C;ZN; 11×PEG; 12×EDO;PGE;SPD;1PE;ACY;GUN;TRS;5j8a2-206
High-resolution structure of the Escherichia coli ribosome Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
266×MG;PG4; 14×MPD; 16×PUT;ZN; 11×PEG; 12×EDO;PGE;SPD;1PE;ACY;GUN;TRS;5it82-206
Crystal structure of the E. coli 70S ribosome in an intermediate state of ratcheting Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Crystal structure of the E. coli ribosome bound to chloramphenicol. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Crystal Structure of Release Factor RF3 Trapped in the GTP State on a Rotated Conformation of the R… Heteromer
P02358; P02359; P02413; P0A7I4; P0A7J3; P0A7J7; P0A7K2; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
NMY; 170×MG;ZN;4v522-206
Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8X9M2;
Crystal structure of the E. coli ribosome bound to telithromycin. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Crystal structure of the E. coli ribosome bound to clindamycin. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recyclin… Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q9WX76;
Allosteric control of the ribosome by small-molecule antibiotics Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
224×MG; 10×NMY;ZN;4v9c2-206
Structure of the E coli 70S ribosome with the U1060A mutation in 16S rRNA Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
266×MG;PG4; 14×MPD; 16×PUT;ZN; 11×PEG; 12×EDO;PGE;SPD;1PE;ACY;GUN;TRS;5j882-206
Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Crystal structure of the bacterial ribosome from Escherichia coli in complex with the antibiotic ka… Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA15; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG58; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
KSG; 170×MG;4v4h2-206
Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and… Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
NMY; 170×MG;SCM;ZN;4v572-206
Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Crystal Structure of Release Factor RF3 Trapped in the GTP State on a Rotated Conformation of the R… Heteromer
P02358; P02359; P02413; P0A7I4; P0A7J3; P0A7J7; P0A7K2; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Crystal structure of the E. coli 70S ribosome in an intermediate state of ratcheting Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of PDF binding helix in complex with the ribosome Heteromer
P02358; P02359; P02413; P0A6K3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R6; P0A7R9; P0A7S4; P0A7T1; P0A7T3; P0A7T9; P0A7U3; P0A7U7; P0A7V1; P0A7V4; P0A7W1; P0A7W7; P0A7X4; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68680; P68919;
Crystal structure of the E. coli 70S ribosome in an intermediate state of ratcheting Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
E. coli pH03H9 complex Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68919;
Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ri… Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q9WX76;
Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and r… Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q9WX76;
70S ribosome bound with cognate ternary complex base-paired to A site codon (Structure II) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P0CE47; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
E. coli 70S-fMetVal-tRNAVal-tRNAfMet complex in intermediate post-translocation state (post2b) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of tmRNA SmpB bound in A site of E. coli 70S ribosome Heteromer
A0A029HJ91; A0A0E0XV41; A0A379XJZ2; D7X2Z6; D7XAL4; E3PKZ6; H4IXV7; P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M9; P0A7N9; P0A7P5; P0A7Q1; P0A7R1; P0A7R5; P0A7R9; P0A7T7; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A832; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG55; P0AG59; P0AG63; P0C018; P60438; P60624; P60723; P62399; P68679; P68919; S0UHH0; U9ZUL7; V0A5J4;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure II-C1) Heteromer
A0A037Y8L6; A0A069XRX8; A0A073FNB4; A0A080IK26; A0A0E2L017; A0A0H3GYM7; A0A1X3KX08; A0A1X3LC97; A0A222QU44; A0A376HTV6; A0A4P8C2I6; A0A4Y8DMK0; A0A5B7PA13; B7MGC4; B7MIU7; C3TPN2; D6I208; D7X302; D7XH79; D7XKZ6; D7XN21; D7Z9F6; D7Z9G0; D7Z9G3; D7ZEN7; D7ZET0; D7ZI15; D8A1L7; E2QFJ4; E3PJQ3; F4SQ43; F4TL26; F4TL27; G0F552; I2UH22; I2X0X3; I2X1N4; J7RMJ2; L3CCT0; L3NSS9; L3PZ69; P0ADY7; P60422; P60438; S1CG62; S1D5F0; S1ERR4; S1EUW9; T6N332; T9TH92; U9YFU2; V6FZ95;
Structure of the ribosome-SecYE complex in the membrane environment Heteromer
A0A454A8B1; A0A454AA55; P02358; P02359; P02413; P02647; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8X9Y5;
101×PEV; 32×PGV;4v6m2-206
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Non-cognate Structure V… Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of 30S ribosomal subunit and RNA polymerase complex in non-rotated state Heteromer
A8A4M2; B7MAE3; B7MB86; B7MBF0; B7MBZ1; B7MCR2; B7MCR3; B7MCS1; B7MCS2; B7MCS6; B7MCS9; B7MCT1; B7MCT6; B7MCV6; B7MCV7; B7MFL0; B7MIU7; B7MIX3; B7MLK7; B7NGD4; P0A7T1; P0A7W3; P0A7Z6; P0A8T8;
Structure of SelB-Sec-tRNASec bound to the 70S ribosome in the initial binding state (IB) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P14081; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
RF2 accommodated state bound Release complex 70S at 24 ms Heteromer
P02358; P02359; P02413; P07012; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
RsgA-GDPNP bound to the 30S ribosomal subunit (RsgA assembly intermediate without uS3) Heteromer
P02358; P02359; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7W1; P0A7W7; P0A7X3; P0ADZ4; P0AG59; P0AG63; P39286;
Structure of a hibernating 100S ribosome reveals an inactive conformation of the ribosomal protein … Heteromer
P02358; P02359; P02413; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AFW2; P0AFX0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0AG67; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structural characterization of mRNA-tRNA translocation intermediates (50S ribosome of class2 of the… Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8X9M2;
70S ribosome bound with near-cognate ternary complex base-paired to A site codon, open 30S (Structu… Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P0CE47; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM structure of a rotated E. coli 70S ribosome in complex with RF3-GDPCP(RF3-only) Heteromer
P02358; P02359; P02413; P0A7I4; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8WSY8;
Structure of the Ribosome with Elongation Factor G Trapped in the Pre-Translocation State (pre-tran… Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM structure of the proline-rich antimicrobial peptide Api137 bound to the terminating ribosome Heteromer
P02358; P02359; P02413; P0A7I0; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8WSY8;
70S ribosome bound with near-cognate ternary complex base-paired to A site codon, closed 30S (Struc… Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P0CE47; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure III-C) Heteromer
A0A037Y8L6; A0A080IK26; A0A0E2L017; A0A1X3KX08; A0A376HTV6; A0A4Y8DMK0; B7MGC4; B7MIU7; C3TPN2; D6I1Y5; D6I208; D6I3M6; D7X302; D7XH79; D7XKZ6; D7XN21; D7Z9F6; D7Z9G0; D7Z9G3; D7ZEN7; D7ZET0; D7ZI15; D8A1L7; E0J6I2; E2QFJ4; E3PJQ3; E9TH65; E9YV47; F4SQ43; F4TL26; F4TL27; G0F552; I2UH22; I2X0X3; I2X1N4; I2X5R7; I2XAW2; J7RMJ2; L3CCT0; L3NSS9; L3PZ69; P0ADY7; P60422; P60438; S1CG62; S1D5F0; S1ERR4; S1EUW9; T6N332; T9TH92; U9YFU2; V6FZ95;
Structure of tmRNA SmpB bound past E site of E. coli 70S ribosome Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0A832; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
70S ribosome-EF-Tu H84A complex with GTP and near-cognate tRNA (Complex C3) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P0CE48; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
FME; 1413×MG;K;PHE;GTP;5wfk2-206
70S structure prior to bypassing Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P23992; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of the Ribosome with Elongation Factor G Trapped in the Pre-Translocation State (pre-tran… Heteromer
P02358; P02359; P02413; P0A6M8; P0A7J3; P0A7J7; P0A7K2; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of Escherichia coli EF4 in posttranslocational ribosomes (Post EF4) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P60785; P61175; P62399; P68679; P68919;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure V-A) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structures of ribosome-bound initiation factor 2 reveal the mechanism of subunit association: Initi… Heteromer
P02358; P02359; P02413; P0A705; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
The cryo-EM structure of YjeQ bound to the 30S subunit suggests a fidelity checkpoint function for … Heteromer
B7MBZ1; B7MCR3; B7MCS1; B7MCS6; B7MCV7; B7MLK7; P02358; P02359; P0A7R5; P0A7S9; P0A7T3; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0ADZ4; P0AG59; P39286;
RF2 pre-accommodated state bound Release complex 70S at 24ms Heteromer
P02358; P02359; P02413; P07012; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
E. coli 70S-fMetVal-tRNAVal-tRNAfMet complex in classic pre-translocation state (pre1a) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure IV-A) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Activation of GTP Hydrolysis in mRNA-tRNA Translocation by Elongation Factor G Heteromer
P02358; P02359; P02413; P0A6M8; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8X9M2;
E. coli 70S-fMetVal-tRNAVal-tRNAfMet complex in classic pre-translocation state (pre1b) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of RelA bound to ribosome in presence of A/R tRNA (Structure IV) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG20; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
3.2 A cryo-EM ArfA-RF2 ribosome rescue complex (Structure I) Heteromer
P02358; P02359; P02413; P07012; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P36675; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of the E. coli ribosome and the tRNAs in Post-accommodation state Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P35024; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q3YWV3; Q8X9M2;
E. coli 70S-fMetVal-tRNAVal-tRNAfMet complex in intermediate post-translocation state (post2a) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure II-B2) Heteromer
A0A037Y8L6; A0A069XRX8; A0A073FNB4; A0A080IK26; A0A0E2L017; A0A1X3KX08; A0A1X3LC97; A0A222QU44; A0A376HTV6; A0A4P8C2I6; A0A4Y8DMK0; A0A5B7PA13; B7MGC4; B7MIU7; C3TPN2; D6I208; D7X302; D7XH79; D7XKZ6; D7XN21; D7Z9F6; D7Z9G0; D7Z9G3; D7ZEN7; D7ZET0; D7ZI15; D8A1L7; E2QFJ4; E3PJQ3; E9TH65; F4SQ43; F4TL26; F4TL27; G0F552; I2UH22; I2X0X3; I2X1N4; J7RMJ2; L3CCT0; L3NSS9; L3PZ69; P0ADY7; P60422; P60438; S1CG62; S1D5F0; S1ERR4; S1EUW9; T6N332; T9TH92; U9YFU2; V6FZ95;
70S ribosome-EF-Tu wt complex with GppNHp Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P0CE48; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
70S termination complex with RF2 bound to the UGA codon. Rotated ribosome with RF2 bound (Structure… Heteromer
A0A037Y8L6; A0A0E2KXL3; A0A0E2L017; A0A0E2L2J1; B7MAS6; B7MCR3; B7MCS9; B7MGC4; B7MIU7; B7MIX0; B7N179; D7X2Z9; D7XH79; D7Z814; D7Z9F4; D7Z9F6; D7Z9F9; D7Z9G0; D7Z9G3; D7Z9G4; D7Z9G5; D7Z9G6; D7Z9G7; D7Z9G8; D7Z9G9; D7Z9H0; D7Z9H1; D7Z9H2; D7Z9H3; D7Z9H7; D7Z9P0; D7ZAN0; D7ZAN1; D7ZAS2; D7ZEL4; D7ZEN7; D7ZES9; D7ZET0; D7ZGG2; D7ZI15; D7ZI17; D7ZK99; D7ZKU3; H4UQ02; P0A7L8; P0ADY7; P60422; P60438; S0YB49;
Release complex 70S Heteromer
P02358; P02359; P02413; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of 30S ribosomal subunit and RNA polymerase complex in rotated state Heteromer
A8A4M2; B7MAE3; B7MB86; B7MBF0; B7MBZ1; B7MCR2; B7MCR3; B7MCS1; B7MCS2; B7MCS6; B7MCS9; B7MCT1; B7MCT6; B7MCV6; B7MCV7; B7MFL0; B7MIU7; B7MIX3; B7MLK7; B7NGD4; P0A7T1; P0A7W3; P0A7Z6; P0A8T8;
Structural characterization of mRNA-tRNA translocation intermediates (class 6 of the six classes) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8X9M2;
Cryo-EM structure of the Escherichia coli 70S ribosome in complex with antibiotic Avilamycin C, mRN… Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
RF2 accommodated state bound 70S complex at long incubation time Heteromer
P02358; P02359; P02413; P07012; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of the 70S ribosome with SECIS-mRNA and P-site tRNA (Initial complex, IC) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM structure of an E. coli 70S ribosome in complex with RF3-GDPCP, RF1(GAQ) and Pint-tRNA (Sta… Heteromer
B7LEM0; P02358; P02359; P02413; P0A7I0; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8WSY8;
Cryo-EM structure of tetracycline resistance protein TetM bound to a translating E.coli ribosome Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P21598; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structural insights into cognate vs. near-cognate discrimination during decoding. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P0CE48; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8X9M2;
Active 70S ribosome without free 5S rRNA and bound with A- and P- tRNA Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of RelA bound to ribosome in presence of A/R tRNA (Structure III) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG20; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Tetracycline resistance protein Tet(O) bound to the ribosome Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P10952; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Non-cognate Structure V… Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structures of ribosome-bound initiation factor 2 reveal the mechanism of subunit association Heteromer
P02358; P02359; P02413; P0A705; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
RsgA-GDPNP bound to the 30S ribosomal subunit (RsgA assembly intermediate) Heteromer
P02358; P02359; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7W1; P0A7W7; P0A7X3; P0ADZ4; P0AG59; P0AG63; P39286;
Cryo-EM structure of NusG-CTD bound to 70S ribosome (30S: NusG-CTD fragment) Heteromer
P02358; P02359; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0ADZ4; P0AFG0; P0AG59; P0AG63; P68679;
Structure of the 30S Pre-Initiation Complex 1 (30S IC-1) Stalled by GE81112 Heteromer
A0A0U4BH30; P02358; P02359; P03000; P0A705; P0A707; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0ADZ4; P0AG59; P0AG63; P68679; Q5SHR1;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure I-A) Heteromer
A0A037Y8L6; A0A069XRX8; A0A073FNB4; A0A080IK26; A0A0E2L017; A0A1X3KX08; A0A1X3LC97; A0A222QU44; A0A376HTV6; A0A4P8C2I6; A0A4Y8DMK0; A0A5B7PA13; B7MGC4; B7MIU7; C3TPN2; D6I208; D7X302; D7XH79; D7XKZ6; D7XN21; D7Z9F6; D7Z9G0; D7Z9G3; D7ZEN7; D7ZET0; D7ZI15; D8A1L7; E3PJQ3; E9TH65; F4SQ43; F4TL26; F4TL27; G0F552; I2UH22; I2X0X3; I2X1N4; J7RMJ2; L3CCT0; L3NSS9; L3PZ69; P0ADY7; P60422; P60438; S1CG62; S1D5F0; S1ERR4; S1EUW9; T6N332; T9TH92; U9YFU2; V6FZ95;
70S ribosome-EF-Tu H84A complex with GTP and near-cognate tRNA (Complex C2) Heteromer
A7ZUJ2; A8A4M2; A8A5A4; A8A5A6; B7L4J5; B7LAK9; B7MAE3; B7MAS6; B7MAS7; B7MB86; B7MBF0; B7MBV4; B7MBV5; B7MBZ1; B7MBZ2; B7MCR0; B7MCR2; B7MCR3; B7MCR7; B7MCR9; B7MCS0; B7MCS1; B7MCS2; B7MCS3; B7MCS5; B7MCS6; B7MCS7; B7MCS8; B7MCS9; B7MCT0; B7MCT1; B7MCT2; B7MCT4; B7MCT5; B7MCT6; B7MCV6; B7MCV7; B7MFJ7; B7MFJ8; B7MGC4; B7MI68; B7MIU4; B7MIU7; B7MIW9; B7MIX1; B7MJ76; B7MLK7; B7MLK8; B7NGD4; P0A7T1; P0A7W3; P0ADZ2;
FME; 1480×MG;K;PHE;GTP;5wf02-206
E. coli 70S-fMetVal-tRNAVal-tRNAfMet complex in intermediate post-translocation state (post3b) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM structure of an Escherichia coli 70S ribosome in complex with antibiotic TetracenomycinX Heteromer
P02358; P02359; P02413; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AFX0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
70S termination complex with RF2 bound to the UGA codon. Non-rotated ribosome with RF2 bound (Struc… Heteromer
P02358; P02359; P02413; P07012; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure II-D) Heteromer
A0A037Y8L6; A0A080IK26; A0A0E2L017; A0A1X3KX08; A0A376HTV6; A0A4Y8DMK0; B7MGC4; B7MIU7; C3TPN2; D6I1Y5; D6I208; D6I3M6; D7X302; D7XH79; D7XKZ6; D7XN21; D7Z9F6; D7Z9G0; D7Z9G3; D7ZEN7; D7ZET0; D7ZI15; D8A1L7; E0J6I2; E2QFJ4; E3PJQ3; E9TH65; E9YV47; F4SQ43; F4TL26; F4TL27; G0F552; I2UH22; I2X0X3; I2X1N4; I2X5R7; I2XAW2; J7RMJ2; L3CCT0; L3NSS9; L3PZ69; P0ADY7; P60422; P60438; S1CG62; S1D5F0; S1ERR4; S1EUW9; T6N332; T9TH92; U9YFU2; V6FZ95;
Structure of SelB-Sec-tRNASec bound to the 70S ribosome in the GTPase activated state (GA) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P14081; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
CL; 147×MG;FME;SEC;GNP;ZN;5lzd2-206
Structure of 30S (S1 depleted) ribosomal subunit and RNA polymerase complex Heteromer
A8A4M2; B7MAE3; B7MB86; B7MBF0; B7MBZ1; B7MCR2; B7MCR3; B7MCS1; B7MCS2; B7MCS6; B7MCS9; B7MCT1; B7MCT6; B7MCV6; B7MCV7; B7MFL0; B7MIU7; B7MIX3; B7MLK7; B7NGD4; P0A7T1; P0A7W3; P0A7Z6; P0A8T8;
Structure of RelA bound to ribosome in presence of A/R tRNA (Structure II) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG20; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of RelA bound to ribosome in absence of A/R tRNA (Structure I) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG20; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM structure of an Escherichia coli ribosome-SpeFL complex stalled in response to L-ornithine … Heteromer
A0A4S5AKD5; P02358; P02359; P02413; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
339×MG; 147×K; 1201×UNX;ZN;ORN;6tbv2-206
Mechanisms of Ribosome Stalling by SecM at Multiple Elongation Steps Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62395; P62399; P68679; P68919;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure IV-B) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
70S ribosome with S1 domains 1 and 2 (Class 1) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0AG67; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM structure of an ErmBL-stalled ribosome in complex with P-, and E-tRNA Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
RF1 accommodated 70S complex at 60 ms Heteromer
A0A029IK04; A0A029IKB7; A0A037Y8L6; A0A073FR78; A0A080FR68; A0A080IK26; A0A0E2L017; A0A0G3K5Y7; A0A0G3K7Z5; A0A1X3JB38; A0A1X3JB47; A0A1X3JBH6; A0A2T1LEK9; A0A376HTV6; A0A376ZL25; A0A377MZQ1; B7MGC4; B7MIU7; C3TPN2; D6IC61; D7XH79; D7XN21; D7Z9F6; D7Z9G0; D7Z9G5; D7ZEN7; D7ZET0; D7ZI15; D7ZI16; D8A1L7; H4LIZ0; I2RJ64; I4T5W9; J7R6H0; J7R6H7; J7RLQ6; L3C5D9; L3PZ69; L4V1L2; P0A7R9; P0ADY7; P60438; S1D5F0; S1EK76; T9TH92; U9XYH0; V0AXZ0;
3.2 A cryo-EM ArfA-RF2 ribosome rescue complex (Structure II) Heteromer
P02358; P02359; P02413; P07012; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P36675; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM structure of a rotated E. coli 70S ribosome in complex with RF3-GDPCP, RF1(GAQ) and P/E-tRN… Heteromer
P02358; P02359; P02413; P0A7I0; P0A7I4; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8WSY8;
Cryo-EM structure of stringent response factor RelA bound to ErmCL-stalled ribosome complex Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG20; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structural characterization of mRNA-tRNA translocation intermediates (class 5 of the six classes) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8X9M2;
RF1 pre-accommodated 70S complex at 24 ms Heteromer
A0A0E2L017; P02358; P02359; P02413; P0A7I0; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
E. coli 70S-fMetVal-tRNAVal-tRNAfMet complex in intermediate pre-translocation state (pre3) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
E. coli 70S-fMetVal-tRNAVal-tRNAfMet complex in classic post-translocation state (post1) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of the E. coli ribosome in the Pre-accommodation state Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P35024; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q3YWV3; Q8X9M2;
70S ribosome without free 5S rRNA and with a perturbed PTC Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure II-B1) Heteromer
A0A037Y8L6; A0A069XRX8; A0A073FNB4; A0A080IK26; A0A0E2L017; A0A1X3KX08; A0A1X3LC97; A0A222QU44; A0A376HTV6; A0A4P8C2I6; A0A4Y8DMK0; A0A5B7PA13; B7MGC4; B7MIU7; C3TPN2; D6I208; D7X302; D7XH79; D7XKZ6; D7XN21; D7Z9F6; D7Z9G0; D7Z9G3; D7ZEN7; D7ZET0; D7ZI15; D8A1L7; E2QFJ4; E3PJQ3; E9TH65; F4SQ43; F4TL26; F4TL27; G0F552; I2UH22; I2X0X3; I2X1N4; J7RMJ2; L3CCT0; L3NSS9; L3PZ69; P0ADY7; P60422; P60438; S1CG62; S1D5F0; S1ERR4; S1EUW9; T6N332; T9TH92; U9YFU2; V6FZ95;
E. coli 70S-fMetVal-tRNAVal-tRNAfMet complex in hybrid pre-translocation state (pre5a) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM structure of an Escherichia coli ribosome-SpeFL complex stalled in response to L-ornithine … Heteromer
A0A4S5AKD5; P02358; P02359; P02413; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
339×MG; 147×K; 1201×UNX;ZN;ORN;6tc32-206
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Non-cognate Structure V… Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
70S initiation complex Heteromer
P02358; P02359; P02413; P0A705; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structural insights into cognate vs. near-cognate discrimination during decoding. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P0CE48; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8X9M2;
Role of Era in Assembly and Homeostasis of the Ribosomal Small Subunit Heteromer
D7ZI16; D8A1L7; F4SQ43; P02358; P0A7R5; P0A7T3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0ADZ4; P0AG59; P0AG63; V6FZ95;
E. coli 70S-fMetVal-tRNAVal post-translocation complex (post4) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
E. coli 70S-fMetVal-tRNAVal-tRNAfMet complex in intermediate post-translocation state (post3a) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of tmRNA SmpB bound in P site of E. coli 70S ribosome Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; U9Y9P1;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure III-A) Heteromer
A0A037Y8L6; A0A080IK26; A0A0E2L017; A0A1X3K2N0; A0A1X3KX08; A0A376HTV6; A0A4P8C2I6; A0A4Y8DMK0; B7L4K1; B7MGC4; B7MIU7; C3TPN2; D6IFL9; D7X302; D7XH79; D7XN21; D7Z9F6; D7Z9G0; D7Z9G3; D7ZEN7; D7ZET0; D7ZI15; D8A1L7; E0J6I2; E1IKL4; E2QFJ4; E3PJQ3; E9TH65; F4SQ43; H4JDL7; H4KMR7; I2UH22; I2X1W0; I2X5R7; I2X5X6; I2X6E7; L3NSS9; L3P526; L3PZ69; P0ADY7; P60422; P60438; S1CG62; S1D5F0; S1EUW9; T6L9R3; T6N332; T9TH92; U9ZRE0; U9ZRE5; V0AIT6; V6FZ95;
Structural characterization of mRNA-tRNA translocation intermediates (class 4b of the six classes) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8X9M2;
70S ribosome-EF-Tu H84A complex with GTP and cognate tRNA Heteromer
A7ZSJ9; P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P0CE48; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
FME; 662×MG;K;PHE;GTP;5we62-206
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure II-C2) Heteromer
E2QFJ4; P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
70S termination complex with RF2 bound to the UAG codon. Rotated ribosome conformation (Structure V) Heteromer
A0A037Y8L6; A0A0E2KXL3; A0A0E2L017; A0A0E2L2J1; B7MAS6; B7MCR3; B7MCS9; B7MGC4; B7MIU7; B7MIX0; B7N179; D7X2Z9; D7XH79; D7Z814; D7Z9F4; D7Z9F6; D7Z9F9; D7Z9G0; D7Z9G3; D7Z9G4; D7Z9G5; D7Z9G6; D7Z9G7; D7Z9G8; D7Z9G9; D7Z9H0; D7Z9H1; D7Z9H2; D7Z9H3; D7Z9H7; D7Z9P0; D7ZAN0; D7ZAN1; D7ZAS2; D7ZEL4; D7ZEN7; D7ZES9; D7ZET0; D7ZGG2; D7ZI15; D7ZI17; D7ZK99; D7ZKU3; H4UQ02; P0A7L8; P0ADY7; P60422; P60438; S0YB49;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Non-cognate Structure I… Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Polyproline-stalled ribosome in the presence of elongation-factor P (EF-P) Heteromer
P02358; P02359; P02413; P0A6N4; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Release factor-dependent ribosome rescue by BrfA in the Gram-positive bacterium Bacillus subtilis Heteromer
P02358; P02359; P02413; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P28367; P54573; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of the bacterial ribosome complexed by tmRNA-SmpB and EF-G during translocation and MLD-l… Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of the 70S ribosome with Sec-tRNASec in the classical pre-translocation state (C) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM structure of an ErmBL-stalled ribosome in complex with A-, P-, and E-tRNA Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Non-rotated ribosome (Structure I) Heteromer
P02358; P02359; P02413; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
E. coli 70S-fMetVal-tRNAVal-tRNAfMet complex in hybrid pre-translocation state (pre4) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of SelB-Sec-tRNASec bound to the 70S ribosome in the codon reading state (CR) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P14081; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structure of the 30S Pre-Initiation Complex 2 (30S IC-2) Stalled by GE81112 Heteromer
A0A0U4BH30; P02358; P02359; P03000; P0A705; P0A707; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0ADZ4; P0AG59; P0AG63; P68679; Q5SHR1;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure I-B) Heteromer
A0A037Y8L6; A0A080IK26; A0A0E2L017; A0A1X3KX08; A0A376HTV6; A0A4Y8DMK0; B7MGC4; B7MIU7; C3TPN2; D7X302; D7XH79; D7XN21; D7Z9F6; D7Z9G0; D7Z9G3; D7ZEN7; D7ZET0; D7ZI15; D8A1L7; F4SQ43; L3PZ69; P0ADY7; P60422; P60438; S1CG62; S1D5F0; T6N332; T9TH92; V6FZ95;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Non-cognate Structure V… Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
RsgA-GDPNP bound to the 30S ribosomal subunit (RsgA assembly intermediate with uS3) Heteromer
P02358; P02359; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0ADZ4; P0AG59; P0AG63; P39286;
E. coli 70S d2d8 stapled ribosome Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Conformation of methylated GGQ in the peptidyl transferase center during translation termination Heteromer
B7M1M6; B7MCT1; B7MCT2; P02358; P02359; P02413; P07012; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P36675; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structural basis for ArfA-RF2 mediated translation termination on stop-codon lacking mRNAs Heteromer
P02358; P02359; P02413; P07012; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P36675; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM structure of an E. coli 70S ribosome in complex with RF3-GDPCP, RF1(GAQ) and Pint-tRNA (Sta… Heteromer
P02358; P02359; P02413; P0A7I0; P0A7I4; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8WSY8;
70S ribosome bound with near-cognate ternary complex not base-paired to A site codon (Structure I-n… Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P0CE47; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure III-B) Heteromer
A0A037Y8L6; A0A080IK26; A0A0E2L017; A0A1X3KX08; A0A376HTV6; A0A4Y8DMK0; B7MGC4; B7MIU7; C3TPN2; D6I1Y5; D6I208; D6I3M6; D7X302; D7XH79; D7XKZ6; D7XN21; D7Z9F6; D7Z9G0; D7Z9G3; D7ZEN7; D7ZET0; D7ZI15; D8A1L7; E0J6I2; E2QFJ4; E3PJQ3; E9TH65; E9YV47; F4SQ43; F4TL26; F4TL27; G0F552; I2UH22; I2X0X3; I2X1N4; I2X5R7; I2XAW2; J7RMJ2; L3CCT0; L3NSS9; L3PZ69; P0ADY7; P60422; P60438; S1CG62; S1D5F0; S1ERR4; S1EUW9; T6N332; T9TH92; U9YFU2; V6FZ95;
Structural characterization of mRNA-tRNA translocation intermediates (class 3 of the six classes) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8X9M2;
70S ribosome-EF-Tu H84A complex with GppNHp Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P0CE48; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
FME; 1904×MG;K;PHE;GNP;5wdt2-206
Structure of the 70S ribosome with fMetSec-tRNASec in the hybrid pre-translocation state (H) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
E. coli expressome Heteromer
P02358; P02359; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0A7Z4; P0A800; P0A8T7; P0A8V2; P0ADZ4; P0AG59; P0AG63; P68679;
E. coli 70S-fMetVal-tRNAVal-tRNAfMet complex in intermediate pre-translocation state (pre2) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Activation of GTP Hydrolysis in mRNA-tRNA Translocation by Elongation Factor G Heteromer
P02358; P02359; P02413; P0A6M8; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8X9M2;
70S-fMetVal-tRNAVal-tRNAfMet complex in hybrid pre-translocation state (pre5b) Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure V-B) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
E.coli RF1 bound to E.coli 70S ribosome in response to UAU sense A-site codon Heteromer
B7MAE3; B7MAS6; B7MAS7; B7MB86; B7MBF0; B7MBV4; B7MBV5; B7MBZ1; B7MBZ2; B7MCR2; B7MCR3; B7MCR7; B7MCR9; B7MCS0; B7MCS1; B7MCS2; B7MCS3; B7MCS5; B7MCS6; B7MCS7; B7MCS8; B7MCS9; B7MCT0; B7MCT1; B7MCT2; B7MCT3; B7MCT4; B7MCT5; B7MCT6; B7MCV6; B7MCV7; B7MFJ7; B7MFJ8; B7MGC4; B7MI68; B7MIU4; B7MIU7; B7MIW9; B7MIX0; B7MIX1; B7MJ76; B7MKB3; B7MLK7; B7MLK8; B7N179; P02358; P02413; P0A7Q6; P0A7S9; P0A7W1; P60624; P68679; P68919;
70S ribosome bound with cognate ternary complex base-paired to A site codon, closed 30S (Structure … Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P0CE47; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
70S ribosome bound with cognate ternary complex not base-paired to A site codon (Structure I) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P0CE47; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
70S Elongation Competent Ribosome Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Structural characterization of mRNA-tRNA translocation intermediates (class 4a of the six classes) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8X9M2;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Non-cognate Structure I… Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM structure of the Escherichia coli 70S ribosome in complex with antibiotic Evernimycin, mRNA… Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K2; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P21598; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
70S ribosome-EF-Tu H84A complex with GTP and near-cognate tRNA (Complex C4) Heteromer
A7ZUJ2; A8A4M2; A8A5A4; A8A5A6; B7L4J5; B7LAK9; B7MAE3; B7MAS6; B7MAS7; B7MB86; B7MBF0; B7MBV4; B7MBV5; B7MBZ1; B7MBZ2; B7MCR0; B7MCR2; B7MCR3; B7MCR7; B7MCR9; B7MCS0; B7MCS1; B7MCS2; B7MCS3; B7MCS5; B7MCS6; B7MCS7; B7MCS8; B7MCS9; B7MCT0; B7MCT1; B7MCT2; B7MCT4; B7MCT5; B7MCT6; B7MCV6; B7MCV7; B7MFJ7; B7MFJ8; B7MGC4; B7MI68; B7MIU4; B7MIU7; B7MIW9; B7MIX1; B7MJ76; B7MLK7; B7MLK8; B7NGD4; P0A7T1; P0A7W3; P0ADZ2;
FME; 1471×MG;K;PHE;GTP;5wfs2-206
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure II-A) Heteromer
A0A037Y8L6; A0A073FNB4; A0A080IK26; A0A0E2L017; A0A1X3KX08; A0A376HTV6; A0A4Y8DMK0; A0A5B7PA13; B7MGC4; B7MIU7; C3TPN2; D6I1Y5; D6I208; D7X302; D7XH79; D7XKZ6; D7XN21; D7Z9F6; D7Z9G0; D7Z9G3; D7ZEN7; D7ZET0; D7ZI15; D8A1L7; E0J6I2; E2QFJ4; E3PJQ3; E9TH65; F4SQ43; F4TL26; F4TL27; G0F552; I2UH22; I2X0X3; I2X1N4; I2X5R7; I2XAW2; J7RMJ2; L3CCT0; L3NSS9; L3PZ69; P0ADY7; P60422; P60438; S1CG62; S1D5F0; S1ERR4; S1EUW9; T6N332; T9TH92; U9YFU2; V6FZ95;
70S termination complex with RF2 bound to the UGA codon. Partially rotated ribosome with RF2 bound … Heteromer
A0A037Y8L6; A0A0E2KXL3; A0A0E2L017; A0A0E2L2J1; B7MAS6; B7MCR3; B7MCS9; B7MGC4; B7MIU7; B7MIX0; B7N179; D7X2Z9; D7XH79; D7Z814; D7Z9F4; D7Z9F6; D7Z9F9; D7Z9G0; D7Z9G3; D7Z9G4; D7Z9G5; D7Z9G6; D7Z9G7; D7Z9G8; D7Z9G9; D7Z9H0; D7Z9H1; D7Z9H2; D7Z9H3; D7Z9H7; D7Z9P0; D7ZAN0; D7ZAN1; D7ZAS2; D7ZEL4; D7ZEN7; D7ZES9; D7ZET0; D7ZGG2; D7ZI15; D7ZI17; D7ZK99; D7ZKU3; H4UQ02; P0A7L8; P0ADY7; P60422; P60438; S0YB49;
Cryo-EM structure of a polyproline-stalled ribosome in the absence of EF-P Heteromer
P02358; P02359; P02413; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
E. coli 70S-RNAP expressome complex in uncoupled state 6 Heteromer
A0A090BZW5; A0A2X1PTA3; C3SFP7; C3SQR7; C3SQT7; C3SQW2; C3SQX2; C3SQY7; C3SR07; C3SR12; C3SR52; C3SR57; C3SR62; C3SRY2; C3SSQ7; C3STZ7; C3SYP2; C3TPN2; C3TRH7; P02359; P02413; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7R1; P0A7Z4; P0A800; P0A8T8; P0A8V4; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68919; U9XX47; W8T6F0;
rrn anti-termination complex Heteromer
P0A780; P0A7R5; P0A7Z4; P0A800; P0A8T7; P0A8V2; P0ADG4; P0AFF6; P0AFG0;
E. coli 70S-RNAP expressome complex in collided state bound to NusG Heteromer
A0A2X1PTA3; A0A6D2WI95; C3SID2; P02359; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0A7Z4; P0A800; P0A8T8; P0A8V2; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; W8T6F0;
E. coli 70S-RNAP expressome complex in uncoupled state 2 Heteromer
A0A090BZW5; A0A2X1PTA3; C3SFP7; C3SQR7; C3SQT7; C3SQW2; C3SQX2; C3SQY7; C3SR07; C3SR12; C3SR52; C3SR57; C3SR62; C3SRY2; C3SSQ7; C3STZ7; C3SYP2; C3TPN2; C3TRH7; P02359; P02413; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7R1; P0A7Z4; P0A800; P0A8T8; P0A8V4; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68919; U9XX47; W8T6F0;
E. coli 70S-RNAP expressome complex in collided state without NusG Heteromer
A0A090BZW5; A0A2X1PTA3; C3SFP7; C3SQR7; C3SQT7; C3SQW2; C3SQX2; C3SQY7; C3SR07; C3SR12; C3SR52; C3SR57; C3SR62; C3SRY2; C3SSQ7; C3STZ7; C3SYP2; C3TPN2; C3TRH7; P02359; P02413; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7R1; P0A7Z4; P0A8T8; P0A8V4; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68919; W8T6F0;
E. coli 70S-RNAP expressome complex in uncoupled state 1 Heteromer
A0A090BZW5; A0A2X1PTA3; C3SFP7; C3SQR7; C3SQT7; C3SQW2; C3SQX2; C3SQY7; C3SR07; C3SR12; C3SR52; C3SR57; C3SR62; C3SRY2; C3SSQ7; C3STZ7; C3SYP2; C3TPN2; C3TRH7; P02359; P02413; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7R1; P0A7Z4; P0A800; P0A8T8; P0A8V4; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68919; U9XX47; W8T6F0;
30S-Inactivated-high-Mg2+ Class A Heteromer
P02358; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0ADZ4; P0AG59; P0AG63;
30S-Inactive-high-Mg2+ + carbon layer Heteromer
P02358; P02359; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0ADZ4; P0AG59; P0AG63;
E. coli 70S ribosome in complex with dirithromycin, fMet-Phe-tRNA(Phe) and deacylated tRNA(iMet) (f… Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
E. coli 70S ribosome in complex with dirithromycin, and deacylated tRNA(iMet) (focused classificati… Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
30S-Activated-high-Mg2+ Heteromer
P02358; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0ADZ4; P0AG59; P0AG63;
30S-Inactive-low-Mg2+ Class B Heteromer
P02358; P0A7S3; P0A7T3; P0A7U7; P0A7W1; P0A7W7; P0ADZ4; P0AG63;
30S-Inactive-low-Mg2+ Class A Heteromer
P0A7R5; P0A7S3; P0A7S9; P0A7T3; P0A7U3; P0A7U7; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0ADZ4; P0AG59; P0AG63;
ArfB Rescue of a 70S Ribosome stalled on truncated mRNA with a partial A-site codon (+2-IV) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P40711; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Rotated 70S ribosome stalled on long mRNA with ArfB-1 and ArfB-2 bound in the A site (+9-IV) Heteromer
A0A4S5ALA4; P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P40711; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
ArfB Rescue of a 70S Ribosome stalled on truncated mRNA with a partial A-site codon (+2-III) Heteromer
P02358; P02359; P02413; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P40711; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
70S ribosome stalled on long mRNA with ArfB bound in the A site Heteromer
P02358; P02359; P02413; P0A7J3; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P40711; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
ArfB Rescue of a 70S Ribosome stalled on truncated mRNA with a partial A-site codon (+2-II) Heteromer
P02358; P02359; P02413; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P40711; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
70S ribosome stalled on long mRNA with ArfB-1 and ArfB-2 bound (+9-III) Heteromer
P02358; P02359; P02413; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P40711; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM structure of an E. coli 70S ribosome in complex with RF3-GDPCP, RF1(GAQ) and Pint-tRNA (Sta… Heteromer
P02358; P02359; P02413; P0A7I0; P0A7I4; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Polyproline-stalled ribosome in the presence of A+P site tRNA and elongation-factor P (EF-P) Heteromer
P02358; P02359; P02413; P0A6N4; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure VI-B) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure VI-A) Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;
Ribosome-SecY complex. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P60422; P60438; P60460; P60624; P60723; P61175; P62399; P68679; P68919; Q8X9M2;
Ternary complex-bound E.coli 70S ribosome. Heteromer
P02358; P02359; P02413; P0A7J7; P0A7K6; P0A7L0; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P0CE48; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919; Q8X9M2;
Structure of the P+9 ArfB-ribosome complex in the post-hydrolysis state Heteromer
A0A024L8R9; A0A073UC57; C3SFP7; C3SQT7; C3SQW2; C3SQX2; C3SQY7; C3SR12; C3SR27; C3SR52; C3SR57; C3SR62; C3SRY2; C3SSQ7; C3STZ7; C3SYP2; C3TPN2; C3TRH7; I2UHF1; I2X5X6; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68919; Q8WSY8; U9XX47;
Structure of the P+9 ArfB-ribosome complex with P/E hybrid tRNA in the post-hydrolysis state Heteromer
A0A024L8R9; A0A073UC57; A0A0H3ENK5; C3SFP7; C3SQT7; C3SQW2; C3SQX2; C3SQY7; C3SR12; C3SR27; C3SR52; C3SR57; C3SR62; C3SRY2; C3SSQ7; C3STZ7; C3SYP2; C3TPN2; C3TRH7; I2UHF1; I2X5X6; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68919; Q8WSY8; U9XX47;
Structure of trans-translation inhibitor bound to E. coli 70S ribosome with P site tRNA Heteromer
A0A037Y8L6; A0A0E2KXL3; A0A0E2L017; A0A0E2L2J1; B7MAS6; B7MCR3; B7MCS9; B7MGC4; B7MIU7; D7X2Z9; D7XH79; D7Z814; D7Z9F4; D7Z9F6; D7Z9F9; D7Z9G0; D7Z9G3; D7Z9G4; D7Z9G5; D7Z9G6; D7Z9G7; D7Z9G8; D7Z9G9; D7Z9H0; D7Z9H1; D7Z9H2; D7Z9H3; D7Z9H7; D7Z9P0; D7ZAS2; D7ZEL4; D7ZEN7; D7ZES9; D7ZET0; D7ZFP6; D7ZGG2; D7ZI15; D7ZK99; D7ZKU3; H4UQ02; L4V1L2; P02358; P0A7L8; P0ADY7; P60422; P60438; S0YB49;
Structure of the P+9 stalled ribosome complex Heteromer
A0A073UC57; C3SFP7; C3SQR7; C3SQT7; C3SQW2; C3SQX2; C3SQY7; C3SR07; C3SR12; C3SR27; C3SR52; C3SR57; C3SR62; C3SRY2; C3SSQ7; C3STZ7; C3SYP2; C3TPN2; C3TRH7; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68919; V0YYV3;
Structure of the Bacterial Ribosome at 2 Angstrom Resolution Heteromer
A0A037Y8L6; A0A0E2KXL3; A0A0E2L017; A0A0E2L2J1; B7MAS6; B7MCS9; B7MGC4; B7MIU7; D6I1Y5; D7X2Z9; D7XH79; D7Z814; D7Z9F4; D7Z9F6; D7Z9F9; D7Z9G0; D7Z9G3; D7Z9G4; D7Z9G5; D7Z9G6; D7Z9G7; D7Z9G8; D7Z9G9; D7Z9H0; D7Z9H1; D7Z9H2; D7Z9H3; D7Z9H7; D7Z9P0; D7ZAS2; D7ZEL4; D7ZEN7; D7ZES9; D7ZET0; D7ZFP6; D7ZGG2; D7ZI15; D7ZK99; D7ZKU3; H4UQ02; I2UHF1; I2X6U5; L4V2J8; P02358; P0A7L8; P60422; S0YB49; S1ELC2;
PAR; 309×MG; 16×SPD;SPM;ZN;7k002-206
30S initiation complex Heteromer
A0A069XYI1; A0A080IK26; A0A090BZT4; A0A1X3KX08; A0A376HTV6; B6I217; B7MIU7; D7X302; D7XN21; D8A1L7; F4SQ43; L3BXG0; L3PZ69; P0A7R9; S1CG62; S1D5F0; T6N332; T9TH92; U9ZNW8; V6FZ95;
Structure of the P+0 ArfB-ribosome complex in the post-hydrolysis state Heteromer
A0A024L8R9; A0A073UC57; C3SFP7; C3SQR7; C3SQT7; C3SQW2; C3SQX2; C3SQY7; C3SR07; C3SR12; C3SR27; C3SR52; C3SR57; C3SR62; C3SRY2; C3SSQ7; C3STZ7; C3SYP2; C3TPN2; C3TRH7; P02413; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0AG44; P0AG48; P0AG51; P0AG55; P0C018; P60422; P60438; P60624; P60723; P61175; P62399; P68919; Q8WSY8;
2.9A Structure of E. coli ribosome-EF-TU complex by cs-corrected cryo-EM Heteromer
P02358; P02359; P02413; P0A7J3; P0A7J7; P0A7K6; P0A7L3; P0A7L8; P0A7M2; P0A7M6; P0A7M9; P0A7N4; P0A7N9; P0A7P5; P0A7Q1; P0A7Q6; P0A7R1; P0A7R5; P0A7R9; P0A7S3; P0A7S9; P0A7T3; P0A7T7; P0A7U3; P0A7U7; P0A7V0; P0A7V3; P0A7W1; P0A7W7; P0A7X3; P0AA10; P0ADY3; P0ADY7; P0ADZ0; P0ADZ4; P0AG44; P0AG48; P0AG51; P0AG55; P0AG59; P0AG63; P0C018; P0CE48; P60422; P60438; P60624; P60723; P61175; P62399; P68679; P68919;